PDB entry 2aze

View 2aze on RCSB PDB site
Description: Structure of the Rb C-terminal domain bound to an E2F1-DP1 heterodimer
Class: cell cycle, transcription
Keywords: coiled coil, beta sandwich
Deposited on 2005-09-10, released 2006-01-31
The last revision prior to the SCOP 1.73 freeze date was dated 2006-01-31, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.221
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcription factor Dp-1
    Species: HOMO SAPIENS
    Gene: TFDP1, DP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14186 (3-End)
      • cloning artifact (2)
    Domains in SCOP 1.73: d2azea1
  • Chain 'B':
    Compound: Transcription factor E2F1
    Species: HOMO SAPIENS
    Gene: E2F1, RBBP3
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2azeb1
  • Chain 'C':
    Compound: Retinoblastoma-associated protein
    Species: HOMO SAPIENS
    Gene: RB1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2azec1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2azeA (A:)
    gefaqecqnleverqrrlerikqkqsqlqelilqqiafknlvqrnrhaeqqasrppppns
    vihlpfiivntskktvidcsisndkfeylfnfdntfeihddievlkrmgmacglesgscs
    aedlkmarslvpkalepyvtemaqgtvggvfitta
    

    Sequence, based on observed residues (ATOM records): (download)
    >2azeA (A:)
    faqecqnleverqrrlerikqkqsqlqelilqqiafknlvqrnrhaeqqasrppppnsvi
    hlpfiivntskktvidcsisndkfeylfnfdntfeihddievlkrmgmacglesgscsae
    dlkmarslvpkalepyvtemaqgtvggvf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2azeB (B:)
    gshmggrlegltqdlrqlqeseqqldhlmnicttqlrllsedtdsqrlayvtcqdlrsia
    dpaeqmvmvikappetqlqavdssenfqislkskqgpidvflcpee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2azeB (B:)
    grlegltqdlrqlqeseqqldhlmnicttqlrllsedtdsqrlayvtcqdlrsiadpaeq
    mvmvikappetqlqavdssenfqislkskqgpidvflcpee
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2azeC (C:)
    srilvsigesfgtsekfqkinqmvcnsdrvlkrsaegsnppkplkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2azeC (C:)
    srilvsigesfgtsekfqkinqmvcnsdrvlkrsaegsnppkpl