PDB entry 2azd

View 2azd on RCSB PDB site
Description: X-Ray studies on Maltodextrin Phosphorylase (MalP) Complexes: recognition of substrates and CATALYTIC mechanism of phosphorylase family
Class: Transferase
Keywords: maltopentaose, carbohydrate recognition, phosphorylase mechanism, ternary complexes with natural and inhibitory substrates, Transferase
Deposited on 2005-09-10, released 2005-09-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.16 Å
R-factor: 0.207
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: maltodextrin phosphorylase
    Species: Escherichia coli [TaxId:562]
    Gene: EG10560
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00490 (0-795)
      • engineered (260-262)
    Domains in SCOPe 2.07: d2azda_
  • Chain 'B':
    Compound: maltodextrin phosphorylase
    Species: Escherichia coli [TaxId:562]
    Gene: EG10560
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00490 (0-795)
      • engineered (260-262)
    Domains in SCOPe 2.07: d2azdb_
  • Heterogens: VO4, PLP, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2azdA (A:)
    sqpifndkqfqealsrqwqryglnsaaemtprqwwlavsealaemlraqpfakpvanqrh
    vnyismefligrltgnnllnlgwyqdvqdslkaydinltdlleeeidpalgngglgrlaa
    cfldsmatvgqsatgyglnyqyglfrqsfvdgkqveapddwhrsnypwfrhnealdvqvg
    iggkvtkdgrwepeftitgqawdlpvvgyrngvaqplrlwqathahpfdltkfndgdflr
    aeqqginaekltkvlypndnafegkklrlmqqyfqcacsvadilrrhhlagrklhelady
    eviqlndthptiaipellrvlidehqmswddawaitsktfaytnhtlmpealerwdvklv
    kgllprhmqiineintrfktlvektwpgdekvwaklavvhdkqvhmanlcvvggfavngv
    aalhsdlvvkdlfpeyhqlwpnkfhnvtngitprrwikqcnpalaalldkslqkewandl
    dqlinlekfaddakfrqqyreikqankvrlaefvkvrtgieinpqaifdiqikrlheykr
    qhlnllhilalykeirenpqadrvprvflfgakaapgyylakniifainkvadvinndpl
    vgdklkvvflpdycvsaaeklipaadiseqistagkeasgtgnmklalngaltvgtldga
    nveiaekvgeenififghtveqvkailakgydpvkwrkkdkvldavlkelesgkysdgdk
    hafdqmlhsigkqggdpylvmadfaayveaqkqvdvlyrdqeawtraailntarcgmfss
    drsirdyqariwqakr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2azdB (B:)
    sqpifndkqfqealsrqwqryglnsaaemtprqwwlavsealaemlraqpfakpvanqrh
    vnyismefligrltgnnllnlgwyqdvqdslkaydinltdlleeeidpalgngglgrlaa
    cfldsmatvgqsatgyglnyqyglfrqsfvdgkqveapddwhrsnypwfrhnealdvqvg
    iggkvtkdgrwepeftitgqawdlpvvgyrngvaqplrlwqathahpfdltkfndgdflr
    aeqqginaekltkvlypndnafegkklrlmqqyfqcacsvadilrrhhlagrklhelady
    eviqlndthptiaipellrvlidehqmswddawaitsktfaytnhtlmpealerwdvklv
    kgllprhmqiineintrfktlvektwpgdekvwaklavvhdkqvhmanlcvvggfavngv
    aalhsdlvvkdlfpeyhqlwpnkfhnvtngitprrwikqcnpalaalldkslqkewandl
    dqlinlekfaddakfrqqyreikqankvrlaefvkvrtgieinpqaifdiqikrlheykr
    qhlnllhilalykeirenpqadrvprvflfgakaapgyylakniifainkvadvinndpl
    vgdklkvvflpdycvsaaeklipaadiseqistagkeasgtgnmklalngaltvgtldga
    nveiaekvgeenififghtveqvkailakgydpvkwrkkdkvldavlkelesgkysdgdk
    hafdqmlhsigkqggdpylvmadfaayveaqkqvdvlyrdqeawtraailntarcgmfss
    drsirdyqariwqakr