PDB entry 2aza

View 2aza on RCSB PDB site
Description: structure of azurin from alcaligenes denitrificans. refinement at 1.8 angstroms resolution and comparison of the two crystallographically independent molecules
Deposited on 1986-10-14, released 1987-01-15
The last revision prior to the SCOP 1.55 freeze date was dated 1990-01-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.157
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d2azaa_
  • Chain 'B':
    Domains in SCOP 1.55: d2azab_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2azaA (A:)
    aqceatiesndamqydlkemvvdksckqftvhlkhvgkmaksamghnwvltkeadkegva
    tdgmnaglaqdyvkagdtrviahtkvigggesdsvtfdvskltpgeayayfcsfpghwam
    mkgtlklsn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2azaB (B:)
    aqceatiesndamqydlkemvvdksckqftvhlkhvgkmaksamghnwvltkeadkegva
    tdgmnaglaqdyvkagdtrviahtkvigggesdsvtfdvskltpgeayayfcsfpghwam
    mkgtlklsn