PDB entry 2az8

View 2az8 on RCSB PDB site
Description: HIV-1 Protease NL4-3 in complex with inhibitor, TL-3
Class: hydrolase/hydrolase inhibitor
Keywords: HIV-1, protease, inhibitor, TL-3, HYDROLASE-HYDROLASE INHIBITOR COMPLEX
Deposited on 2005-09-09, released 2006-02-28
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.234
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protease retropepsin
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03367 (0-98)
      • variant (6)
      • variant (36)
    Domains in SCOPe 2.04: d2az8a_
  • Heterogens: 3TL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2az8A (A:)
    pqitlwkrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvniigrnlltqigctlnf