PDB entry 2az2

View 2az2 on RCSB PDB site
Description: Flock House virus B2-dsRNA Complex (P4122)
Class: Viral protein/RNA
Keywords: protein-rna complex, four-helix bundle, Viral protein/RNA COMPLEX
Deposited on 2005-09-09, released 2005-10-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.245
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: B2 protein
    Species: Flock house virus [TaxId:12287]
    Gene: B2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2az2a_
  • Chain 'B':
    Compound: B2 protein
    Species: Flock house virus [TaxId:12287]
    Gene: B2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2az2b_
  • Chain 'C':
    Compound: 5'-r(*gp*cp*ap*(5bu)p*gp*gp*ap*cp*gp*cp*gp*(5bu)p*cp*cp*ap*(5bu)p*gp*c)-3'
  • Chain 'D':
    Compound: 5'-r(*gp*cp*ap*(5bu)p*gp*gp*ap*cp*gp*cp*gp*(5bu)p*cp*cp*ap*(5bu)p*gp*c)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2az2A (A:)
    mpsklaliqelpdriqtaveaamgmsyqdapnnvrrdldnlhaclnkakltvsrmvtsll
    ekpsvvaylegka
    

    Sequence, based on observed residues (ATOM records): (download)
    >2az2A (A:)
    psklaliqelpdriqtaveaamgmsyqdapnnvrrdldnlhaclnkakltvsrmvtslle
    kpsvvayleg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2az2B (B:)
    mpsklaliqelpdriqtaveaamgmsyqdapnnvrrdldnlhaclnkakltvsrmvtsll
    ekpsvvaylegka
    

    Sequence, based on observed residues (ATOM records): (download)
    >2az2B (B:)
    psklaliqelpdriqtaveaamgmsyqdapnnvrrdldnlhaclnkakltvsrmvtslle
    kpsvvayleg
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.