PDB entry 2az1

View 2az1 on RCSB PDB site
Description: Structure of a halophilic nucleoside diphosphate kinase from Halobacterium salinarum
Class: transferase
Keywords: halophilic, surface charges, TRANSFERASE
Deposited on 2005-09-09, released 2005-12-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleoside diphosphate kinase
    Species: Halobacterium salinarum [TaxId:2242]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2az1a1
  • Chain 'B':
    Compound: Nucleoside diphosphate kinase
    Species: Halobacterium salinarum [TaxId:2242]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2az1b_
  • Chain 'C':
    Compound: Nucleoside diphosphate kinase
    Species: Halobacterium salinarum [TaxId:2242]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2az1c_
  • Chain 'D':
    Compound: Nucleoside diphosphate kinase
    Species: Halobacterium salinarum [TaxId:2242]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2az1d_
  • Chain 'E':
    Compound: Nucleoside diphosphate kinase
    Species: Halobacterium salinarum [TaxId:2242]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2az1e_
  • Chain 'F':
    Compound: Nucleoside diphosphate kinase
    Species: Halobacterium salinarum [TaxId:2242]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2az1f_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2az1A (A:)
    mgsshhhhhhssglvprgshmtdhdertfvmvkpdgvqrgligdivtrletkglkmvggk
    fmrideelahehyaehedkpffdglvsfitsgpvfamvwegadatrqvrqlmgatdaqda
    apgtirgdygndlghnlihgsdhedeganereialffdddelvdwdrdasawvyedladh
    d
    

    Sequence, based on observed residues (ATOM records): (download)
    >2az1A (A:)
    hdertfvmvkpdgvqrgligdivtrletkglkmvggkfmrideelahehyaehedkpffd
    glvsfitsgpvfamvwegadatrqvrqlmgatdaqdaapgtirgdygndlghnlihgsdh
    edeganereialffdddelvdwdrdasawvyedla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2az1B (B:)
    mgsshhhhhhssglvprgshmtdhdertfvmvkpdgvqrgligdivtrletkglkmvggk
    fmrideelahehyaehedkpffdglvsfitsgpvfamvwegadatrqvrqlmgatdaqda
    apgtirgdygndlghnlihgsdhedeganereialffdddelvdwdrdasawvyedladh
    d
    

    Sequence, based on observed residues (ATOM records): (download)
    >2az1B (B:)
    dhdertfvmvkpdgvqrgligdivtrletkglkmvggkfmrideelahehyaeffdglvs
    fitsgpvfamvwegadatrqvrqlmgatdaqdaapgtirgdygndlghnlihgsdhedeg
    anereialffdddelvdwdrdasawvyedla
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2az1C (C:)
    mgsshhhhhhssglvprgshmtdhdertfvmvkpdgvqrgligdivtrletkglkmvggk
    fmrideelahehyaehedkpffdglvsfitsgpvfamvwegadatrqvrqlmgatdaqda
    apgtirgdygndlghnlihgsdhedeganereialffdddelvdwdrdasawvyedladh
    d
    

    Sequence, based on observed residues (ATOM records): (download)
    >2az1C (C:)
    hdertfvmvkpdgvqrgligdivtrletkglkmvggkfmrideelahehyaehedkpffd
    glvsfitsgpvfamvwegadatrqvrqlmgatdaqdaapgtirgdygndlghnlihgsdh
    edeganereialffdddelvdwdrdasawvyedla
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2az1D (D:)
    mgsshhhhhhssglvprgshmtdhdertfvmvkpdgvqrgligdivtrletkglkmvggk
    fmrideelahehyaehedkpffdglvsfitsgpvfamvwegadatrqvrqlmgatdaqda
    apgtirgdygndlghnlihgsdhedeganereialffdddelvdwdrdasawvyedladh
    d
    

    Sequence, based on observed residues (ATOM records): (download)
    >2az1D (D:)
    hdertfvmvkpdgvqrgligdivtrletkglkmvggkfmrideelahehyaehedkpffd
    glvsfitsgpvfamvwegadatrqvrqlmgatdaqdaapgtirgdygndlghnlihgsdh
    edeganereialffdddelvdwdrdasawvyedla
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2az1E (E:)
    mgsshhhhhhssglvprgshmtdhdertfvmvkpdgvqrgligdivtrletkglkmvggk
    fmrideelahehyaehedkpffdglvsfitsgpvfamvwegadatrqvrqlmgatdaqda
    apgtirgdygndlghnlihgsdhedeganereialffdddelvdwdrdasawvyedladh
    d
    

    Sequence, based on observed residues (ATOM records): (download)
    >2az1E (E:)
    dertfvmvkpdgvqrgligdivtrletkglkmvggkfmrideelahehyaehedkpffdg
    lvsfitsgpvfamvwegadatrqvrqlmgatdaqdaapgtirgdygndlghnlihgsdhe
    deganereialffdddelvdwdrdasawvyedla
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2az1F (F:)
    mgsshhhhhhssglvprgshmtdhdertfvmvkpdgvqrgligdivtrletkglkmvggk
    fmrideelahehyaehedkpffdglvsfitsgpvfamvwegadatrqvrqlmgatdaqda
    apgtirgdygndlghnlihgsdhedeganereialffdddelvdwdrdasawvyedladh
    d
    

    Sequence, based on observed residues (ATOM records): (download)
    >2az1F (F:)
    dhdertfvmvkpdgvqrgligdivtrletkglkmvggkfmrideelahehyaehfdglvs
    fitsgpvfamvwegadatrqvrqlmgatdaqdaapgtirgdygndlghnlihgsdhedeg
    anereialffdddelvdwdrdasawvyedla