PDB entry 2ayz

View 2ayz on RCSB PDB site
Description: Solution structure of the E.coli RcsC C-terminus (residues 817-949) containing phosphoreceiver domain
Class: transferase
Keywords: phosphoreceiver domain, transferase
Deposited on 2005-09-09, released 2006-09-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sensor kinase protein rcsC
    Species: Escherichia coli [TaxId:562]
    Gene: rcsC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ayza1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ayzA (A:)
    kavsdnddmmilvvddhpinrrlladqlgslgyqcktandgvdalnvlsknhidivlsdv
    nmpnmdgyrltqrirqlgltlpvigvtanalaeekqrclesgmdsclskpvtldvikqtl
    tlyaervrksrds