PDB entry 2ayx

View 2ayx on RCSB PDB site
Description: Solution structure of the E.coli RcsC C-terminus (residues 700-949) containing linker region and phosphoreceiver domain
Class: transferase
Keywords: Two independent structural domains, TRANSFERASE
Deposited on 2005-09-09, released 2006-09-26
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sensor kinase protein rcsC
    Species: Escherichia coli [TaxId:562]
    Gene: rcsC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14376 (4-253)
      • cloning artifact (0-3)
    Domains in SCOPe 2.01: d2ayxa1, d2ayxa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ayxA (A:)
    mggsgveglsgkrcwlavrnaslcqfletslqrsgivvttyegqeptpedvlitdevvsk
    kwqgravvtfcrrhigiplekapgewvhsvaaphelpallariyliemesddpanalpst
    dkavsdnddmmilvvddhpinrrlladqlgslgyqcktandgvdalnvlsknhidivlsd
    vnmpnmdgyrltqrirqlgltlpvigvtanalaeekqrclesgmdsclskpvtldvikqt
    ltlyaervrksrds