PDB entry 2ayw

View 2ayw on RCSB PDB site
Description: Crystal Structure of the complex formed between trypsin and a designed synthetic highly potent inhibitor in the presence of benzamidine at 0.97 A resolution
Class: hydrolase
Keywords: trypsin, benzamidine, inhibitor, HYDROLASE
Deposited on 2005-09-09, released 2006-01-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 0.97 Å
R-factor: N/A
AEROSPACI score: 0.86 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2aywa_
  • Heterogens: CA, ONO, BEN, MES, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2aywA (A:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn