PDB entry 2ayv

View 2ayv on RCSB PDB site
Description: Crystal structure of a putative ubiquitin-conjugating enzyme E2 from Toxoplasma gondii
Class: ligase
Keywords: Structural Genomics, Structural Genomics Consortium, ubiquitin, ubiquitin-conjugating enzyme, SGC, LIGASE
Deposited on 2005-09-08, released 2005-09-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.226
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-conjugating enzyme E2
    Species: Toxoplasma gondii [TaxId:5811]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2AYV (Start-165)
    Domains in SCOPe 2.06: d2ayva1, d2ayva2
  • Heterogens: UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ayvA (A:)
    mgsshhhhhhssgrenlyfqgalkrinkelndlskdpptncsagpvgddmfhwqatimgp
    edspysggvfflnihfpsdypfkppkvnfttkiyhpninsqgaicldilkdqwspaltis
    kvllsisslltdpnpddplvpeiahlyksdrmrydqtarewsqkya
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ayvA (A:)
    fqgalkrinkelndlskdpptncsagpvgddmfhwqatimgpedspysggvfflnihfps
    dypfkppkvnfttkiyhpninsqgaicldilkdqwspaltiskvllsisslltdpnpddp
    lvpeiahlyksdrmrydqtarewsqkya