PDB entry 2ays

View 2ays on RCSB PDB site
Description: A conserved non-metallic binding site in the C-terminal lobe of lactoferrin: Structure of the complex of C-terminal lobe of bovine lactoferrin with N-acetyl galactosamine at 1.86 A resolution
Class: transport protein
Keywords: C-lobe, complex, lactoferrin, TRANSPORT PROTEIN
Deposited on 2005-09-08, released 2005-09-20
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.182
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lactotransferrin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24627 (0-End)
      • see remark 999 (223)
      • see remark 999 (266)
    Domains in SCOPe 2.03: d2aysa_
  • Heterogens: NAG, A2G, ZN, FE, CO3, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2aysA (A:)
    ytrvvwcavgpeeqkkcqqwsqqsgqnvtcatasttddcivlvlkgeadalnldggyiyt
    agkcglvpvlaenrksskhssldcvlrptegylavavvkkanegltwnslkdkkschtav
    drtagwnipmglivnqtgscafdeffsqscapgadpksrlcalcagddqgldkcvpnske
    kyygytgafrclaedvgdvafvkndtvwentngestadwaknlkredfrllcldgtrkpv
    teaqschlavapnhavvsrsdraahveqvllhqqalfgkngkncpdkfclfksetknllf
    ndnteclaklggrptyeeylgteyvtaianlkkcstsplleacafltr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aysA (A:)
    ytrvvwcavgpeeqkkcqqwsqqsgqnvtcatasttddcivlvlkgeadalnldggyiyt
    agkcglvpvlaenrksskhssldcvlrptegylavavvkkanegltwnslkdkkschtav
    drtagwnipmglivnqtgscafdeffsqscapgadpksrlcalcagddqgldkcvpnske
    kyygytgafrclaedvgdvafvkndtvwentngestadwaknlkredfrllcldgtrkpv
    teaqschlavapnhavvsrsdraahveqvllhqqalfgkngkncpdkfclfksetknllf
    ndnteclaklggrptyeeylgteyvtaianlkkcsleaca