PDB entry 2ayq

View 2ayq on RCSB PDB site
Description: 3-isopropylmalate dehydrogenase from the moderate facultative thermophile, bacillus coagulans
Deposited on 1998-02-20, released 1998-05-27
The last revision prior to the SCOP 1.69 freeze date was dated 1998-05-27, with a file datestamp of 1998-05-27.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.18
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d2ayqa_
  • Chain 'B':
    Domains in SCOP 1.69: d2ayqb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ayqA (A:)
    mkmklavlpgdgigpevmdaairvlktvldndgheavfenaliggaaideagtplpeetl
    dicrrsdaillgavggpkwdhnpaslrpekgllglrkemglfanlrpvkayatllnaspl
    krervenvdlvivreltgglyfgrpserrgpgenevvdtlaytreeieriiekafqlaqi
    rrkklasvdkanvlessrmwreiaeetakkypdvelshmlvdstsmqlianpgqfdvivt
    enmfgdilsdeasvitgslgmlpsaslrsdrfgmyepvhgsapdiagqgkanplgtvlsa
    almlrysfglekeaaaiekavddvlqdgyctgdlqvangkvvstieltdrlieklnnsaa
    rprifq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ayqA (A:)
    mkmklavlpgdgigpevmdaairvlktvldndgheavfenaliggaaideagtplpeetl
    dicrrsdaillgavggpkwdhnpaslrpekgllglrkemglfanlrpvkayatllnaspl
    krervenvdlvivreltgglyfgrpserrgpgenevvdtlaytreeieriiekafqlaqi
    rrkklasvdkanvlessrmwreiaeetakkypdvelshmlvdstsmqlianpgqfdvivt
    enmfgdilsdeasvitgslgmlpsaslrsdrfgmyepvhgsapdiagqgkanplgtvlsa
    almlrysfglekeaaaiekavddvlqdgyctgdlqvangkvvstieltdrliekln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ayqB (B:)
    mkmklavlpgdgigpevmdaairvlktvldndgheavfenaliggaaideagtplpeetl
    dicrrsdaillgavggpkwdhnpaslrpekgllglrkemglfanlrpvkayatllnaspl
    krervenvdlvivreltgglyfgrpserrgpgenevvdtlaytreeieriiekafqlaqi
    rrkklasvdkanvlessrmwreiaeetakkypdvelshmlvdstsmqlianpgqfdvivt
    enmfgdilsdeasvitgslgmlpsaslrsdrfgmyepvhgsapdiagqgkanplgtvlsa
    almlrysfglekeaaaiekavddvlqdgyctgdlqvangkvvstieltdrlieklnnsaa
    rprifq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ayqB (B:)
    mkmklavlpgdgigpevmdaairvlktvldndgheavfenaliggaaideagtplpeetl
    dicrrsdaillgavggpkwdhnpaslrpekgllglrkemglfanlrpvkayatllnaspl
    krervenvdlvivreltgglyfgrpserrgpgenevvdtlaytreeieriiekafqlaqi
    rrkklasvdkanvlessrmwreiaeetakkypdvelshmlvdstsmqlianpgqfdvivt
    enmfgdilsdeasvitgslgmlpsaslrsdrfgmyepvhgsapdiagqgkanplgtvlsa
    almlrysfglekeaaaiekavddvlqdgyctgdlqvangkvvstieltdrlieklnn