PDB entry 2ayq

View 2ayq on RCSB PDB site
Description: 3-isopropylmalate dehydrogenase from the moderate facultative thermophile, bacillus coagulans
Class: oxidoreductase
Keywords: oxidoreductase, 3-isopropylmalate dehydrogenase, leucine biosynthesis, moderate thermophile
Deposited on 1998-02-20, released 1998-05-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.18
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-isopropylmalate dehydrogenase
    Species: Bacillus coagulans [TaxId:1398]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ayqa_
  • Chain 'B':
    Compound: 3-isopropylmalate dehydrogenase
    Species: Bacillus coagulans [TaxId:1398]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ayqb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ayqA (A:)
    mkmklavlpgdgigpevmdaairvlktvldndgheavfenaliggaaideagtplpeetl
    dicrrsdaillgavggpkwdhnpaslrpekgllglrkemglfanlrpvkayatllnaspl
    krervenvdlvivreltgglyfgrpserrgpgenevvdtlaytreeieriiekafqlaqi
    rrkklasvdkanvlessrmwreiaeetakkypdvelshmlvdstsmqlianpgqfdvivt
    enmfgdilsdeasvitgslgmlpsaslrsdrfgmyepvhgsapdiagqgkanplgtvlsa
    almlrysfglekeaaaiekavddvlqdgyctgdlqvangkvvstieltdrlieklnnsaa
    rprifq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ayqA (A:)
    mkmklavlpgdgigpevmdaairvlktvldndgheavfenaliggaaideagtplpeetl
    dicrrsdaillgavggpkwdhnpaslrpekgllglrkemglfanlrpvkayatllnaspl
    krervenvdlvivreltgglyfgrpserrgpgenevvdtlaytreeieriiekafqlaqi
    rrkklasvdkanvlessrmwreiaeetakkypdvelshmlvdstsmqlianpgqfdvivt
    enmfgdilsdeasvitgslgmlpsaslrsdrfgmyepvhgsapdiagqgkanplgtvlsa
    almlrysfglekeaaaiekavddvlqdgyctgdlqvangkvvstieltdrliekln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ayqB (B:)
    mkmklavlpgdgigpevmdaairvlktvldndgheavfenaliggaaideagtplpeetl
    dicrrsdaillgavggpkwdhnpaslrpekgllglrkemglfanlrpvkayatllnaspl
    krervenvdlvivreltgglyfgrpserrgpgenevvdtlaytreeieriiekafqlaqi
    rrkklasvdkanvlessrmwreiaeetakkypdvelshmlvdstsmqlianpgqfdvivt
    enmfgdilsdeasvitgslgmlpsaslrsdrfgmyepvhgsapdiagqgkanplgtvlsa
    almlrysfglekeaaaiekavddvlqdgyctgdlqvangkvvstieltdrlieklnnsaa
    rprifq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ayqB (B:)
    mkmklavlpgdgigpevmdaairvlktvldndgheavfenaliggaaideagtplpeetl
    dicrrsdaillgavggpkwdhnpaslrpekgllglrkemglfanlrpvkayatllnaspl
    krervenvdlvivreltgglyfgrpserrgpgenevvdtlaytreeieriiekafqlaqi
    rrkklasvdkanvlessrmwreiaeetakkypdvelshmlvdstsmqlianpgqfdvivt
    enmfgdilsdeasvitgslgmlpsaslrsdrfgmyepvhgsapdiagqgkanplgtvlsa
    almlrysfglekeaaaiekavddvlqdgyctgdlqvangkvvstieltdrlieklnn