PDB entry 2ayp

View 2ayp on RCSB PDB site
Description: Crystal Structure of CHK1 with an Indol Inhibitor
Class: transferase
Keywords: Protein-Inhibitor Complex
Deposited on 2005-09-07, released 2006-09-12
The last revision prior to the SCOP 1.73 freeze date was dated 2006-09-12, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.209
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase Chk1
    Species: HOMO SAPIENS
    Gene: CHEK1, CHK1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2aypa1
  • Heterogens: 43A

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2aypA (A:)
    mavpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmkravdcpenikkeicink
    mlnhenvvkfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvy
    lhgigithrdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellk
    rrefhaepvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsapla
    llhkilvenpsaritipdikkdrwynkpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aypA (A:)
    avpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmkravdcpenikkeicinkm
    lnhenvvkfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvyl
    hgigithrdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellkr
    refhaepvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplal
    lhkilvenpsaritipdikkdrwynkpl