PDB entry 2ayn

View 2ayn on RCSB PDB site
Description: Structure of USP14, a proteasome-associated deubiquitinating enzyme
Class: hydrolase
Keywords: deubiquitinating enzymes, DUB, USP14, proteasome, enzyme mechanism, HYDROLASE
Deposited on 2005-09-07, released 2005-10-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.261
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin carboxyl-terminal hydrolase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: USP14, TGT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ayna1
  • Chain 'B':
    Compound: Ubiquitin carboxyl-terminal hydrolase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: USP14, TGT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2aynb1
  • Chain 'C':
    Compound: Ubiquitin carboxyl-terminal hydrolase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: USP14, TGT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2aync1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2aynA (A:)
    dmteeqlasamelpcgltnlgntcymnatvqcirsvpelkdalkryagalrasgemasaq
    yitaalrdlfdsmdktsssippiillqflhmafpqfaekgeqgqylqqdanecwiqmmrv
    lqqkleaieddsvketdsssasaatpskkkslidqffgvefettmkcteseeeevtkgke
    nqlqlscfinqevkylftglklrlqeeitkqsptlqrnalyiksskisrlpayltiqmvr
    ffykekesvnakvlkdvkfplmldmyelctpelqekmvsfrskfkdledkkvnqqpntsd
    kksspqkevkyepfsfaddigsnncgyydlqavlthqgrssssghyvswvkrkqdewikf
    dddkvsivtpedilrlsgggdwhiayvllygprrveimeeeseq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aynA (A:)
    melpcgltnlgntcymnatvqcirsvpelkdalkryagalasaqyitaalrdlfdsmdkt
    sssippiillqflhmafpqfaekgeqgqylqqdanecwiqmmrvlqqkleaieddkslid
    qffgvefettmkcteseeeevtkgkenqlqlscfinqevkylftglklrlqeeitkqspt
    lqrnalyiksskisrlpayltiqmvrffykekesvnakvlkdvkfplmldmyelctpelq
    ekmvsfrskfkdledepfsfaddigsnncgyydlqavlthqgrssssghyvswvkrkqde
    wikfdddkvsivtpedilrlsgggdwhiayvllygpr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2aynB (B:)
    dmteeqlasamelpcgltnlgntcymnatvqcirsvpelkdalkryagalrasgemasaq
    yitaalrdlfdsmdktsssippiillqflhmafpqfaekgeqgqylqqdanecwiqmmrv
    lqqkleaieddsvketdsssasaatpskkkslidqffgvefettmkcteseeeevtkgke
    nqlqlscfinqevkylftglklrlqeeitkqsptlqrnalyiksskisrlpayltiqmvr
    ffykekesvnakvlkdvkfplmldmyelctpelqekmvsfrskfkdledkkvnqqpntsd
    kksspqkevkyepfsfaddigsnncgyydlqavlthqgrssssghyvswvkrkqdewikf
    dddkvsivtpedilrlsgggdwhiayvllygprrveimeeeseq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aynB (B:)
    melpcgltnlgntcymnatvqcirsvpelkdalkryagalasaqyitaalrdlfdsmdkt
    sssippiillqflhmafpqfaekgeqgqylqqdanecwiqmmrvlqqkleaieddkslid
    qffgvefettmkcteseeeevtkgkenqlqlscfinqevkylftglklrlqeeitkqspt
    lqrnalyiksskisrlpayltiqmvrffykekesvnakvlkdvkfplmldmyelctpelq
    ekmvsfrskfkdledepfsfaddigsnncgyydlqavlthqgrssssghyvswvkrkqde
    wikfdddkvsivtpedilrlsgggdwhiayvllygpr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2aynC (C:)
    dmteeqlasamelpcgltnlgntcymnatvqcirsvpelkdalkryagalrasgemasaq
    yitaalrdlfdsmdktsssippiillqflhmafpqfaekgeqgqylqqdanecwiqmmrv
    lqqkleaieddsvketdsssasaatpskkkslidqffgvefettmkcteseeeevtkgke
    nqlqlscfinqevkylftglklrlqeeitkqsptlqrnalyiksskisrlpayltiqmvr
    ffykekesvnakvlkdvkfplmldmyelctpelqekmvsfrskfkdledkkvnqqpntsd
    kksspqkevkyepfsfaddigsnncgyydlqavlthqgrssssghyvswvkrkqdewikf
    dddkvsivtpedilrlsgggdwhiayvllygprrveimeeeseq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aynC (C:)
    melpcgltnlgntcymnatvqcirsvpelkdalkryagalasaqyitaalrdlfdsmdkt
    sssippiillqflhmafpqfaekgeqgqylqqdanecwiqmmrvlqqkleaieddkslid
    qffgvefettmkcteseeeevtkgkenqlqlscfinqevkylftglklrlqeeitkqspt
    lqrnalyiksskisrlpayltiqmvrffykekesvnakvlkdvkfplmldmyelctpelq
    ekmvsfrskfkdledepfsfaddigsnncgyydlqavlthqgrssssghyvswvkrkqde
    wikfdddkvsivtpedilrlsgggdwhiayvllygpr