PDB entry 2aym

View 2aym on RCSB PDB site
Description: Solution Structure of Drosophila melanogaster SNF RBD2
Class: RNA binding protein
Keywords: SNF RBD2, RNA binding, RNA splicing, solution structure, RNA BINDING PROTEIN
Deposited on 2005-09-07, released 2007-02-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: U1 small nuclear ribonucleoprotein A
  Species: Drosophila melanogaster [TaxId:7227]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P43332 (0-82)
  Domains in SCOPe 2.07: d2ayma1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2aymA (A:)
  aqteqppnqilfltnlpeetnemmlsmlfnqfpgfkevrlvpnrhdiafvefttelqsna
  akealqgfkitpthamkitfakk