PDB entry 2ayl

View 2ayl on RCSB PDB site
Description: 2.0 Angstrom Crystal Structure of Manganese Protoporphyrin IX-reconstituted Ovine Prostaglandin H2 Synthase-1 Complexed With Flurbiprofen
Class: oxidoreductase
Keywords: cyclooxygenase, non-steroidal anti-inflammatory drug, peroxidase, prostaglandin synthase, egf-like domain, membrane binding domain, maganese protoporphyrin IX, OXIDOREDUCTASE
Deposited on 2005-09-07, released 2006-01-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Prostaglandin G/H synthase 1
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ayla1, d2ayla2
  • Chain 'B':
    Compound: Prostaglandin G/H synthase 1
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2aylb1, d2aylb2
  • Heterogens: BOG, FLP, MNH, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2aylA (A:)
    pvnpccyypcqhqgicvrfgldryqcdctrtgysgpnctipeiwtwlrttlrpspsfihf
    llthgrwlwdfvnatfirdtlmrlvltvrsnlipspptyniahdyiswesfsnvsyytri
    lpsvprdcptpmgtkgkkqlpdaeflsrrfllrrkfipdpqgtnlmfaffaqhfthqffk
    tsgkmgpgftkalghgvdlghiygdnlerqyqlrlfkdgklkyqmlngevyppsveeapv
    lmhyprgippqsqmavgqevfgllpglmlyatiwlrehnrvcdllkaehptwgdeqlfqt
    arliligetikivieeyvqqlsgyflqlkfdpellfgaqfqyrnriamefnqlyhwhplm
    pdsfrvgpqdysyeqflfntsmlvdygvealvdafsrqpagrigggrnidhhilhvavdv
    ikesrvlrlqpfneyrkrfgmkpytsfqeltgekemaaeleelygdidalefypglllek
    chpnsifgesmiemgapfslkgllgnpicspeywkastfggevgfnlvktatlkklvcln
    tktcpyvsfhvpd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2aylB (B:)
    pvnpccyypcqhqgicvrfgldryqcdctrtgysgpnctipeiwtwlrttlrpspsfihf
    llthgrwlwdfvnatfirdtlmrlvltvrsnlipspptyniahdyiswesfsnvsyytri
    lpsvprdcptpmgtkgkkqlpdaeflsrrfllrrkfipdpqgtnlmfaffaqhfthqffk
    tsgkmgpgftkalghgvdlghiygdnlerqyqlrlfkdgklkyqmlngevyppsveeapv
    lmhyprgippqsqmavgqevfgllpglmlyatiwlrehnrvcdllkaehptwgdeqlfqt
    arliligetikivieeyvqqlsgyflqlkfdpellfgaqfqyrnriamefnqlyhwhplm
    pdsfrvgpqdysyeqflfntsmlvdygvealvdafsrqpagrigggrnidhhilhvavdv
    ikesrvlrlqpfneyrkrfgmkpytsfqeltgekemaaeleelygdidalefypglllek
    chpnsifgesmiemgapfslkgllgnpicspeywkastfggevgfnlvktatlkklvcln
    tktcpyvsfhvpd