PDB entry 2ayk

View 2ayk on RCSB PDB site
Description: inhibitor-free catalytic fragment of human fibroblast collagenase, nmr, minimized average structure
Class: metalloprotease
Keywords: matrix metalloproteinase, hydrolase, metalloprotease, glycoprotein
Deposited on 1997-11-06, released 1998-02-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: collagenase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ayka_
  • Heterogens: ZN, CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2aykA (A:)
    vltegnprweqthltyrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadim
    isfvrgdhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahel
    ghslglshstdigalmypsytfsgdvqlaqddidgiqaiygrsqnpvqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aykA (A:)
    prweqthltyrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadimisfvrg
    dhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahelghslgl
    shstdigalmypsytfsgdvqlaqddidgiqaiygrs