PDB entry 2ayj

View 2ayj on RCSB PDB site
Description: Solution structure of 50S ribosomal protein L40e from Sulfolobus solfataricus
Class: translation
Keywords: Zn-binding; beta-strand protein, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, TRANSLATION
Deposited on 2005-09-07, released 2006-08-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2008-12-23, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 50S ribosomal protein L40e
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: rpl40e
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ayja1
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ayjA (A:)
    mpltdpaklqivqqrvflkkvcrkcgalnpiratkcrrchstnlrlkkkelptkkg