PDB entry 2ayi

View 2ayi on RCSB PDB site
Description: Wild-type AmpT from Thermus thermophilus
Class: hydrolase
Keywords: aminopeptidase, metallopeptidase
Deposited on 2005-09-07, released 2005-11-08
The last revision prior to the SCOP 1.75 freeze date was dated 2005-11-29, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3.7 Å
R-factor: 0.308
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aminopeptidase T
    Species: Thermus thermophilus
    Gene: AmpT
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2ayia1
  • Chain 'B':
    Compound: Aminopeptidase T
    Species: Thermus thermophilus
    Gene: AmpT
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2ayib1
  • Chain 'C':
    Compound: Aminopeptidase T
    Species: Thermus thermophilus
    Gene: AmpT
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2ayic1
  • Chain 'D':
    Compound: Aminopeptidase T
    Species: Thermus thermophilus
    Gene: AmpT
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2ayid1
  • Chain 'E':
    Compound: Aminopeptidase T
    Species: Thermus thermophilus
    Gene: AmpT
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2ayie1
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ayiA (A:)
    mdafkrnleklaelairvglnlekgqeviatapieavdfvrllaekayregaslftviyg
    dqelarkrlalapeegldkapawlyegmarafregaarlavsgsdpkaleglppekvgra
    qkanaraykpaleaitefvtnwtivpfahpgwaravfpglpeeeavrrlweaifqatrad
    qedpiaaweahnralhekvaylnarrfhalhfkgpgtdlvvglaeghlwqggatatkggr
    lcnpnlpteevftaphrervegvvrasrplalggtlvegifarfergfavevraekgeev
    lrrlldtdegarrlgevalvpadnpiaktglvffdtlfdenaashiafgqayqenlegrp
    sgeafrkrggneslvhvdwmigseemdvdglyedgtrtplmrrgrwvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ayiA (A:)
    afkrnleklaelairvglnlekgqeviatapieavdfvrllaekayregaslftviygdq
    elarkrlalapeegldkapawlyegmarafregaarlavsgsdpkaleglppekvgraqk
    anaraykpaleaitefvtnwtivpfahpgwaravfpglpeeeavrrlweaifqatpiaaw
    eahnralhekvaylnarrfhalhfkgpgtdlvvglaeghlwqggatatkggrlcnpnlpt
    eevftaphrervegvvrasrplalggtlvegifarfergfavevraekgeevlrrlldtd
    egarrlgevalvpadnpiaktglvffdtlfdenaashiafgqayqenleggeafrkrggn
    eslvhvdwmigseemdvdglyedgtrtplmrrgrwvv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ayiB (B:)
    mdafkrnleklaelairvglnlekgqeviatapieavdfvrllaekayregaslftviyg
    dqelarkrlalapeegldkapawlyegmarafregaarlavsgsdpkaleglppekvgra
    qkanaraykpaleaitefvtnwtivpfahpgwaravfpglpeeeavrrlweaifqatrad
    qedpiaaweahnralhekvaylnarrfhalhfkgpgtdlvvglaeghlwqggatatkggr
    lcnpnlpteevftaphrervegvvrasrplalggtlvegifarfergfavevraekgeev
    lrrlldtdegarrlgevalvpadnpiaktglvffdtlfdenaashiafgqayqenlegrp
    sgeafrkrggneslvhvdwmigseemdvdglyedgtrtplmrrgrwvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ayiB (B:)
    afkrnleklaelairvglnlekgqeviatapieavdfvrllaekayregaslftviygdq
    elarkrlalapeegldkapawlyegmarafregaarlavsgsdpkaleglppekvgraqk
    anaraykpaleaitefvtnwtivpfahpgwaravfpglpeeeavrrlweaifqatpiaaw
    eahnralhekvaylnarrfhalhfkgpgtdlvvglaeghlwqggatatkggrlcnpnlpt
    eevftaphrervegvvrasrplalggtlvegifarfergfavevraekgeevlrrlldtd
    egarrlgevalvpadnpiaktglvffdtlfdenaashiafgqayqenleggeafrkrggn
    eslvhvdwmigseemdvdglyedgtrtplmrrgrwvv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ayiC (C:)
    mdafkrnleklaelairvglnlekgqeviatapieavdfvrllaekayregaslftviyg
    dqelarkrlalapeegldkapawlyegmarafregaarlavsgsdpkaleglppekvgra
    qkanaraykpaleaitefvtnwtivpfahpgwaravfpglpeeeavrrlweaifqatrad
    qedpiaaweahnralhekvaylnarrfhalhfkgpgtdlvvglaeghlwqggatatkggr
    lcnpnlpteevftaphrervegvvrasrplalggtlvegifarfergfavevraekgeev
    lrrlldtdegarrlgevalvpadnpiaktglvffdtlfdenaashiafgqayqenlegrp
    sgeafrkrggneslvhvdwmigseemdvdglyedgtrtplmrrgrwvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ayiC (C:)
    afkrnleklaelairvglnlekgqeviatapieavdfvrllaekayregaslftviygdq
    elarkrlalapeegldkapawlyegmarafregaarlavsgsdpkaleglppekvgraqk
    anaraykpaleaitefvtnwtivpfahpgwaravfpglpeeeavrrlweaifqatpiaaw
    eahnralhekvaylnarrfhalhfkgpgtdlvvglaeghlwqggatatkggrlcnpnlpt
    eevftaphrervegvvrasrplalggtlvegifarfergfavevraekgeevlrrlldtd
    egarrlgevalvpadnpiaktglvffdtlfdenaashiafgqayqenleggeafrkrggn
    eslvhvdwmigseemdvdglyedgtrtplmrrgrwvv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ayiD (D:)
    mdafkrnleklaelairvglnlekgqeviatapieavdfvrllaekayregaslftviyg
    dqelarkrlalapeegldkapawlyegmarafregaarlavsgsdpkaleglppekvgra
    qkanaraykpaleaitefvtnwtivpfahpgwaravfpglpeeeavrrlweaifqatrad
    qedpiaaweahnralhekvaylnarrfhalhfkgpgtdlvvglaeghlwqggatatkggr
    lcnpnlpteevftaphrervegvvrasrplalggtlvegifarfergfavevraekgeev
    lrrlldtdegarrlgevalvpadnpiaktglvffdtlfdenaashiafgqayqenlegrp
    sgeafrkrggneslvhvdwmigseemdvdglyedgtrtplmrrgrwvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ayiD (D:)
    afkrnleklaelairvglnlekgqeviatapieavdfvrllaekayregaslftviygdq
    elarkrlalapeegldkapawlyegmarafregaarlavsgsdpkaleglppekvgraqk
    anaraykpaleaitefvtnwtivpfahpgwaravfpglpeeeavrrlweaifqatpiaaw
    eahnralhekvaylnarrfhalhfkgpgtdlvvglaeghlwqggatatkggrlcnpnlpt
    eevftaphrervegvvrasrplalggtlvegifarfergfavevraekgeevlrrlldtd
    egarrlgevalvpadnpiaktglvffdtlfdenaashiafgqayqenleggeafrkrggn
    eslvhvdwmigseemdvdglyedgtrtplmrrgrwvv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2ayiE (E:)
    mdafkrnleklaelairvglnlekgqeviatapieavdfvrllaekayregaslftviyg
    dqelarkrlalapeegldkapawlyegmarafregaarlavsgsdpkaleglppekvgra
    qkanaraykpaleaitefvtnwtivpfahpgwaravfpglpeeeavrrlweaifqatrad
    qedpiaaweahnralhekvaylnarrfhalhfkgpgtdlvvglaeghlwqggatatkggr
    lcnpnlpteevftaphrervegvvrasrplalggtlvegifarfergfavevraekgeev
    lrrlldtdegarrlgevalvpadnpiaktglvffdtlfdenaashiafgqayqenlegrp
    sgeafrkrggneslvhvdwmigseemdvdglyedgtrtplmrrgrwvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ayiE (E:)
    afkrnleklaelairvglnlekgqeviatapieavdfvrllaekayregaslftviygdq
    elarkrlalapeegldkapawlyegmarafregaarlavsgsdpkaleglppekvgraqk
    anaraykpaleaitefvtnwtivpfahpgwaravfpglpeeeavrrlweaifqatpiaaw
    eahnralhekvaylnarrfhalhfkgpgtdlvvglaeghlwqggatatkggrlcnpnlpt
    eevftaphrervegvvrasrplalggtlvegifarfergfavevraekgeevlrrlldtd
    egarrlgevalvpadnpiaktglvffdtlfdenaashiafgqayqenleggeafrkrggn
    eslvhvdwmigseemdvdglyedgtrtplmrrgrwvv