PDB entry 2ayh

View 2ayh on RCSB PDB site
Description: crystal and molecular structure at 1.6 angstroms resolution of the hybrid bacillus endo-1,3-1,4-beta-d-glucan 4-glucanohydrolase h(a16-m)
Deposited on 1995-02-02, released 1995-03-31
The last revision prior to the SCOP 1.55 freeze date was dated 1995-03-31, with a file datestamp of 1995-03-26.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.143
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d2ayh__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ayh_ (-)
    qtggsffepfnsynsgtwekadgysnggvfnctwrannvnftndgklklgltssaynkfd
    caeyrstniygyglyevsmkpakntgivssfftytgpahgtqwdeidieflgkdttkvqf
    nyytngvgghekvislgfdaskgfhtyafdwqpgyikwyvdgvlkhtatanipstpgkim
    mnlwngtgvddwlgsynganplyaeydwvkytsn