PDB entry 2ayg

View 2ayg on RCSB PDB site
Description: Crystal structure of HPV6a E2 DNA binding domain bound to an 18 base pair DNA target
Class: transcription/DNA
Keywords: beta barrel, double helix, protein-DNA complex
Deposited on 2005-09-07, released 2006-08-22
The last revision prior to the SCOP 1.73 freeze date was dated 2006-10-03, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.247
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Regulatory protein E2
    Species: Human papillomavirus type 6a
    Gene: E2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q84294 (0-86)
      • variant (81)
    Domains in SCOP 1.73: d2ayga1
  • Chain 'B':
    Compound: Regulatory protein E2
    Species: Human papillomavirus type 6a
    Gene: E2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q84294 (0-86)
      • variant (81)
    Domains in SCOP 1.73: d2aygb1
  • Chain 'C':
    Compound: 5'-d(*gp*cp*ap*ap*cp*cp*gp*ap*ap*tp*tp*cp*gp*gp*tp*tp*gp*c)-3'
  • Chain 'D':
    Compound: 5'-d(*gp*cp*ap*ap*cp*cp*gp*ap*ap*tp*tp*cp*gp*gp*tp*tp*gp*c)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2aygA (A:)
    ssatpivqfqgesnclkcfryrlndkhrhlfdlisstwhwaspkaphkhaivtvtyhsee
    qrqqflnvvkipptirhklgfmsmhll
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2aygB (B:)
    ssatpivqfqgesnclkcfryrlndkhrhlfdlisstwhwaspkaphkhaivtvtyhsee
    qrqqflnvvkipptirhklgfmsmhll
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.