PDB entry 2ayg

View 2ayg on RCSB PDB site
Description: Crystal structure of HPV6a E2 DNA binding domain bound to an 18 base pair DNA target
Class: transcription/DNA
Keywords: beta barrel, double helix, protein-DNA complex
Deposited on 2005-09-07, released 2006-08-22
The last revision prior to the SCOP 1.73 freeze date was dated 2006-10-03, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.247
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Regulatory protein E2
  Species: Human papillomavirus type 6a
  Gene: E2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q84294 (0-86)
    • variant (81)
  Domains in SCOP 1.73: d2ayga1
• Chain 'B':
  Compound: Regulatory protein E2
  Species: Human papillomavirus type 6a
  Gene: E2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q84294 (0-86)
    • variant (81)
  Domains in SCOP 1.73: d2aygb1
• Chain 'C':
  Compound: 5'-d(*gp*cp*ap*ap*cp*cp*gp*ap*ap*tp*tp*cp*gp*gp*tp*tp*gp*c)-3'
  
• Chain 'D':
  Compound: 5'-d(*gp*cp*ap*ap*cp*cp*gp*ap*ap*tp*tp*cp*gp*gp*tp*tp*gp*c)-3'
  
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2aygA (A:)
  ssatpivqfqgesnclkcfryrlndkhrhlfdlisstwhwaspkaphkhaivtvtyhsee
  qrqqflnvvkipptirhklgfmsmhll
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2aygB (B:)
  ssatpivqfqgesnclkcfryrlndkhrhlfdlisstwhwaspkaphkhaivtvtyhsee
  qrqqflnvvkipptirhklgfmsmhll
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.