PDB entry 2aye

View 2aye on RCSB PDB site
Description: Crystal structure of the unliganded E2 DNA Binding Domain from HPV6a
Class: transcription
Keywords: beta barrel, TRANSCRIPTION
Deposited on 2005-09-07, released 2006-08-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Regulatory protein E2
    Species: Human papillomavirus - 6 [TaxId:37122]
    Gene: E2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q84294 (Start-86)
      • variant (81)
    Domains in SCOPe 2.08: d2ayea_
  • Chain 'B':
    Compound: Regulatory protein E2
    Species: Human papillomavirus - 6 [TaxId:37122]
    Gene: E2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q84294 (0-86)
      • variant (81)
    Domains in SCOPe 2.08: d2ayeb_
  • Chain 'C':
    Compound: Regulatory protein E2
    Species: Human papillomavirus - 6 [TaxId:37122]
    Gene: E2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q84294 (0-86)
      • variant (81)
    Domains in SCOPe 2.08: d2ayec_
  • Chain 'D':
    Compound: Regulatory protein E2
    Species: Human papillomavirus - 6 [TaxId:37122]
    Gene: E2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q84294 (0-86)
      • variant (81)
    Domains in SCOPe 2.08: d2ayed_
  • Chain 'E':
    Compound: Regulatory protein E2
    Species: Human papillomavirus - 6 [TaxId:37122]
    Gene: E2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q84294 (0-86)
      • variant (81)
    Domains in SCOPe 2.08: d2ayee_
  • Chain 'F':
    Compound: Regulatory protein E2
    Species: Human papillomavirus - 6 [TaxId:37122]
    Gene: E2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q84294 (Start-86)
      • variant (81)
    Domains in SCOPe 2.08: d2ayef_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ayeA (A:)
    ssatpivqfqgesnclkcfryrlndkhrhlfdlisstwhwaspkaphkhaivtvtyhsee
    qrqqflnvvkipptirhklgfmsmhll
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ayeA (A:)
    satpivqfqgesnclkcfryrlndkhrhlfdlisstwhwaspkaphkhaivtvtyhseeq
    rqqflnvvkipptirhklgfmsmhll
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ayeB (B:)
    ssatpivqfqgesnclkcfryrlndkhrhlfdlisstwhwaspkaphkhaivtvtyhsee
    qrqqflnvvkipptirhklgfmsmhll
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ayeC (C:)
    ssatpivqfqgesnclkcfryrlndkhrhlfdlisstwhwaspkaphkhaivtvtyhsee
    qrqqflnvvkipptirhklgfmsmhll
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ayeD (D:)
    ssatpivqfqgesnclkcfryrlndkhrhlfdlisstwhwaspkaphkhaivtvtyhsee
    qrqqflnvvkipptirhklgfmsmhll
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ayeE (E:)
    ssatpivqfqgesnclkcfryrlndkhrhlfdlisstwhwaspkaphkhaivtvtyhsee
    qrqqflnvvkipptirhklgfmsmhll
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2ayeF (F:)
    ssatpivqfqgesnclkcfryrlndkhrhlfdlisstwhwaspkaphkhaivtvtyhsee
    qrqqflnvvkipptirhklgfmsmhll
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ayeF (F:)
    satpivqfqgesnclkcfryrlndkhrhlfdlisstwhwaspkaphkhaivtvtyhseeq
    rqqflnvvkipptirhklgfmsmhll