PDB entry 2ayb

View 2ayb on RCSB PDB site
Description: Crystal structure of HPV6a E2 DNA Binding Domain bound to a 16 base pair DNA target
Class: transcription/DNA
Keywords: Protein-DNA complex, double helix, beta barrel, TRANSCRIPTION-DNA COMPLEX
Deposited on 2005-09-07, released 2006-08-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.259
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Regulatory protein E2
  Species: Human papillomavirus - 6 [TaxId:37122]
  Gene: E2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q84294 (0-86)
    • variant (81)
  Domains in SCOPe 2.05: d2ayba1
• Chain 'B':
  Compound: Regulatory protein E2
  Species: Human papillomavirus - 6 [TaxId:37122]
  Gene: E2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q84294 (0-86)
    • variant (81)
  Domains in SCOPe 2.05: d2aybb1
• Chain 'C':
  Compound: 5'-d(*cp*ap*ap*cp*cp*gp*ap*ap*tp*tp*cp*gp*gp*tp*tp*g)-3'
  
• Chain 'D':
  Compound: 5'-d(*cp*ap*ap*cp*cp*gp*ap*ap*tp*tp*cp*gp*gp*tp*tp*g)-3'
  
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2aybA (A:)
  ssatpivqfqgesnclkcfryrlndkhrhlfdlisstwhwaspkaphkhaivtvtyhsee
  qrqqflnvvkipptirhklgfmsmhll
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2aybB (B:)
  ssatpivqfqgesnclkcfryrlndkhrhlfdlisstwhwaspkaphkhaivtvtyhsee
  qrqqflnvvkipptirhklgfmsmhll
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.