PDB entry 2ayb
View 2ayb on RCSB PDB site
Description: Crystal structure of HPV6a E2 DNA Binding Domain bound to a 16 base pair DNA target
Class: transcription/DNA
Keywords: Protein-DNA complex, double helix, beta barrel, TRANSCRIPTION-DNA COMPLEX
Deposited on
2005-09-07, released
2006-08-22
The last revision prior to the SCOPe 2.05 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.259
AEROSPACI score: 0.14
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Regulatory protein E2
Species: Human papillomavirus - 6 [TaxId:37122]
Gene: E2
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d2ayba1 - Chain 'B':
Compound: Regulatory protein E2
Species: Human papillomavirus - 6 [TaxId:37122]
Gene: E2
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d2aybb1 - Chain 'C':
Compound: 5'-d(*cp*ap*ap*cp*cp*gp*ap*ap*tp*tp*cp*gp*gp*tp*tp*g)-3'
- Chain 'D':
Compound: 5'-d(*cp*ap*ap*cp*cp*gp*ap*ap*tp*tp*cp*gp*gp*tp*tp*g)-3'
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2aybA (A:)
ssatpivqfqgesnclkcfryrlndkhrhlfdlisstwhwaspkaphkhaivtvtyhsee
qrqqflnvvkipptirhklgfmsmhll
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2aybB (B:)
ssatpivqfqgesnclkcfryrlndkhrhlfdlisstwhwaspkaphkhaivtvtyhsee
qrqqflnvvkipptirhklgfmsmhll
- Chain 'C':
No sequence available.
- Chain 'D':
No sequence available.