PDB entry 2ayb

View 2ayb on RCSB PDB site
Description: Crystal structure of HPV6a E2 DNA Binding Domain bound to a 16 base pair DNA target
Class: transcription/DNA
Keywords: Protein-DNA complex, double helix, beta barrel, TRANSCRIPTION-DNA COMPLEX
Deposited on 2005-09-07, released 2006-08-22
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.259
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Regulatory protein E2
    Species: Human papillomavirus - 6 [TaxId:37122]
    Gene: E2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q84294 (0-86)
      • variant (81)
    Domains in SCOPe 2.01: d2ayba1
  • Chain 'B':
    Compound: Regulatory protein E2
    Species: Human papillomavirus - 6 [TaxId:37122]
    Gene: E2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q84294 (0-86)
      • variant (81)
    Domains in SCOPe 2.01: d2aybb1
  • Chain 'C':
    Compound: 5'-d(*cp*ap*ap*cp*cp*gp*ap*ap*tp*tp*cp*gp*gp*tp*tp*g)-3'
  • Chain 'D':
    Compound: 5'-d(*cp*ap*ap*cp*cp*gp*ap*ap*tp*tp*cp*gp*gp*tp*tp*g)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2aybA (A:)
    ssatpivqfqgesnclkcfryrlndkhrhlfdlisstwhwaspkaphkhaivtvtyhsee
    qrqqflnvvkipptirhklgfmsmhll
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2aybB (B:)
    ssatpivqfqgesnclkcfryrlndkhrhlfdlisstwhwaspkaphkhaivtvtyhsee
    qrqqflnvvkipptirhklgfmsmhll
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.