PDB entry 2ay9

View 2ay9 on RCSB PDB site
Description: aromatic amino acid aminotransferase with 5-phenylvaleric acid
Deposited on 1998-08-06, released 1999-02-02
The last revision prior to the SCOP 1.71 freeze date was dated 1999-03-02, with a file datestamp of 1999-03-02.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.175
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d2ay9a_
  • Chain 'B':
    Domains in SCOP 1.71: d2ay9b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ay9A (A:)
    mlgnlkpqapdkilalmgefradprqgkidlgvgvykdatghtpimravhaaeqrmlete
    ttktyaglsgepefqkamgelilgdglksettatlatvggtgalrqalelarmanpdlrv
    fvsdptwpnhvsimnfmglpvqtyryfdaetrgvdfegmkadlaaakkgdmvllhgcchn
    ptganltldqwaeiasilektgalplidlayqgfgdgleedaagtrliasripevliaas
    csknfgiyrertgcllalcadaatrelaqgamaflnrqtysfppfhgakivstvlttpel
    radwmaeleavrsgmlrlreqlagelrdlsgsdrfgfvaehrgmfsrlgatpeqvkrike
    efgiymvgdsriniaglndntipilaraiievgv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ay9B (B:)
    mlgnlkpqapdkilalmgefradprqgkidlgvgvykdatghtpimravhaaeqrmlete
    ttktyaglsgepefqkamgelilgdglksettatlatvggtgalrqalelarmanpdlrv
    fvsdptwpnhvsimnfmglpvqtyryfdaetrgvdfegmkadlaaakkgdmvllhgcchn
    ptganltldqwaeiasilektgalplidlayqgfgdgleedaagtrliasripevliaas
    csknfgiyrertgcllalcadaatrelaqgamaflnrqtysfppfhgakivstvlttpel
    radwmaeleavrsgmlrlreqlagelrdlsgsdrfgfvaehrgmfsrlgatpeqvkrike
    efgiymvgdsriniaglndntipilaraiievgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ay9B (B:)
    mlgnlkpqapdkilalmgefgkidlgvgvykdatghtpimravhaaeqrmletettktya
    glsgepefqkamgelilgdglksettatlatvggtgalrqalelarmanpdlrvfvsdpt
    wpnhvsimnfmglpvqtyryfdaetrgvdfegmkadlaaakkgdmvllhgcchnptganl
    tldqwaeiasilektgalplidlayqgfgdgleedaagtrliasripevliaascsknfg
    iyrertgcllalcadaatrelaqgamaflnrqtysfppfhgakivstvlttpelradwma
    eleavrsgmlrlreqlagelrdlsgsdrfgfvaehrgmfsrlgatpeqvkrikeefgiym
    vgdsriniaglndntipilaraiievgv