PDB entry 2ay7

View 2ay7 on RCSB PDB site
Description: aromatic amino acid aminotransferase with 4-phenylbutyric acid
Deposited on 1998-08-06, released 1999-02-02
The last revision prior to the SCOP 1.71 freeze date was dated 2003-11-04, with a file datestamp of 2003-11-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.157
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d2ay7a_
  • Chain 'B':
    Domains in SCOP 1.71: d2ay7b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ay7A (A:)
    mlgnlkpqapdkilalmgefradprqgkidlgvgvykdatghtpimravhaaeqrmlete
    ttktyaglsgepefqkamgelilgdglksettatlatvggtgalrqalelarmanpdlrv
    fvsdptwpnhvsimnfmglpvqtyryfdaetrgvdfegmkadlaaakkgdmvllhgcchn
    ptganltldqwaeiasilektgalplidlayqgfgdgleedaagtrliasripevliaas
    csknfgiyrertgcllalcadaatrelaqgamaflnrqtysfppfhgakivstvlttpel
    radwmaeleavrsgmlrlreqlagelrdlsgsdrfgfvaehrgmfsrlgatpeqvkrike
    efgiymvgdsriniaglndntipilaraiievgv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ay7B (B:)
    mlgnlkpqapdkilalmgefradprqgkidlgvgvykdatghtpimravhaaeqrmlete
    ttktyaglsgepefqkamgelilgdglksettatlatvggtgalrqalelarmanpdlrv
    fvsdptwpnhvsimnfmglpvqtyryfdaetrgvdfegmkadlaaakkgdmvllhgcchn
    ptganltldqwaeiasilektgalplidlayqgfgdgleedaagtrliasripevliaas
    csknfgiyrertgcllalcadaatrelaqgamaflnrqtysfppfhgakivstvlttpel
    radwmaeleavrsgmlrlreqlagelrdlsgsdrfgfvaehrgmfsrlgatpeqvkrike
    efgiymvgdsriniaglndntipilaraiievgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ay7B (B:)
    mlgnlkpqapdkilalmgefgkidlgvgvykdatghtpimravhaaeqrmletettktya
    glsgepefqkamgelilgdglksettatlatvggtgalrqalelarmanpdlrvfvsdpt
    wpnhvsimnfmglpvqtyryfdaetrgvdfegmkadlaaakkgdmvllhgcchnptganl
    tldqwaeiasilektgalplidlayqgfgdgleedaagtrliasripevliaascsknfg
    iyrertgcllalcadaatrelaqgamaflnrqtysfppfhgakivstvlttpelradwma
    eleavrsgmlrlreqlagelrdlsgsdrfgfvaehrgmfsrlgatpeqvkrikeefgiym
    vgdsriniaglndntipilaraiievgv