PDB entry 2ay5

View 2ay5 on RCSB PDB site
Description: aromatic amino acid aminotransferase with 3-indolepropionic acid
Class: aminotransferase
Keywords: aminotransferase
Deposited on 1998-08-06, released 1999-02-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aromatic amino acid aminotransferase
    Species: Paracoccus denitrificans [TaxId:266]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ay5a_
  • Chain 'B':
    Compound: aromatic amino acid aminotransferase
    Species: Paracoccus denitrificans [TaxId:266]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ay5b_
  • Heterogens: PLP, IOP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ay5A (A:)
    mlgnlkpqapdkilalmgefradprqgkidlgvgvykdatghtpimravhaaeqrmlete
    ttktyaglsgepefqkamgelilgdglksettatlatvggtgalrqalelarmanpdlrv
    fvsdptwpnhvsimnfmglpvqtyryfdaetrgvdfegmkadlaaakkgdmvllhgcchn
    ptganltldqwaeiasilektgalplidlayqgfgdgleedaagtrliasripevliaas
    csknfgiyrertgcllalcadaatrelaqgamaflnrqtysfppfhgakivstvlttpel
    radwmaeleavrsgmlrlreqlagelrdlsgsdrfgfvaehrgmfsrlgatpeqvkrike
    efgiymvgdsriniaglndntipilaraiievgv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ay5B (B:)
    mlgnlkpqapdkilalmgefradprqgkidlgvgvykdatghtpimravhaaeqrmlete
    ttktyaglsgepefqkamgelilgdglksettatlatvggtgalrqalelarmanpdlrv
    fvsdptwpnhvsimnfmglpvqtyryfdaetrgvdfegmkadlaaakkgdmvllhgcchn
    ptganltldqwaeiasilektgalplidlayqgfgdgleedaagtrliasripevliaas
    csknfgiyrertgcllalcadaatrelaqgamaflnrqtysfppfhgakivstvlttpel
    radwmaeleavrsgmlrlreqlagelrdlsgsdrfgfvaehrgmfsrlgatpeqvkrike
    efgiymvgdsriniaglndntipilaraiievgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ay5B (B:)
    mlgnlkpqapdkilalmgefgkidlgvgvykdatghtpimravhaaeqrmletettktya
    glsgepefqkamgelilgdglksettatlatvggtgalrqalelarmanpdlrvfvsdpt
    wpnhvsimnfmglpvqtyryfdaetrgvdfegmkadlaaakkgdmvllhgcchnptganl
    tldqwaeiasilektgalplidlayqgfgdgleedaagtrliasripevliaascsknfg
    iyrertgcllalcadaatrelaqgamaflnrqtysfppfhgakivstvlttpelradwma
    eleavrsgmlrlreqlagelrdlsgsdrfgfvaehrgmfsrlgatpeqvkrikeefgiym
    vgdsriniaglndntipilaraiievgv