PDB entry 2axy

View 2axy on RCSB PDB site
Description: Crystal Structure of KH1 domain of human Poly(C)-binding protein-2 with C-rich strand of human telomeric DNA
Class: DNA binding protein/DNA
Keywords: protein-dna complex
Deposited on 2005-09-06, released 2005-09-27
The last revision prior to the SCOP 1.73 freeze date was dated 2005-11-22, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.215
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Poly(rC)-binding protein 2
    Species: HOMO SAPIENS
    Gene: PCBP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15366 (1-End)
      • cloning artifact (0)
      • modified residue (10)
      • modified residue (29)
      • modified residue (64)
    Domains in SCOP 1.73: d2axya1
  • Chain 'B':
    Compound: Poly(rC)-binding protein 2
    Species: HOMO SAPIENS
    Gene: PCBP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15366 (Start-72)
      • modified residue (10)
      • modified residue (29)
      • modified residue (64)
    Domains in SCOP 1.73: d2axyb1
  • Chain 'C':
    Compound: Poly(rC)-binding protein 2
    Species: HOMO SAPIENS
    Gene: PCBP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15366 (1-End)
      • cloning artifact (0)
      • modified residue (10)
      • modified residue (29)
      • modified residue (64)
    Domains in SCOP 1.73: d2axyc1
  • Chain 'D':
    Compound: Poly(rC)-binding protein 2
    Species: HOMO SAPIENS
    Gene: PCBP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15366 (Start-72)
      • modified residue (10)
      • modified residue (29)
      • modified residue (64)
    Domains in SCOP 1.73: d2axyd1
  • Chain 'E':
    Compound: C-rich strand of human telomeric DNA
  • Chain 'F':
    Compound: C-rich strand of human telomeric DNA
  • Chain 'G':
    Compound: C-rich strand of human telomeric DNA
  • Chain 'H':
    Compound: C-rich strand of human telomeric DNA
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2axyA (A:)
    knvtltirllmhgkevgsiigkkgesvkkmreesgarinisegncperiitlagptnaif
    kafamiidkleed
    

    Sequence, based on observed residues (ATOM records): (download)
    >2axyA (A:)
    knvtltirllmhgkevgsiigkkgesvkkmreesgarinisegncperiitlagptnaif
    kafamiidklee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2axyB (B:)
    knvtltirllmhgkevgsiigkkgesvkkmreesgarinisegncperiitlagptnaif
    kafamiidkleed
    

    Sequence, based on observed residues (ATOM records): (download)
    >2axyB (B:)
    vtltirllmhgkevgsiigkkgesvkkmreesgarinisegncperiitlagptnaifka
    famiidkleed
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2axyC (C:)
    knvtltirllmhgkevgsiigkkgesvkkmreesgarinisegncperiitlagptnaif
    kafamiidkleed
    

    Sequence, based on observed residues (ATOM records): (download)
    >2axyC (C:)
    knvtltirllmhgkevgsiigkkgesvkkmreesgarinisegncperiitlagptnaif
    kafamiidklee
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2axyD (D:)
    knvtltirllmhgkevgsiigkkgesvkkmreesgarinisegncperiitlagptnaif
    kafamiidkleed
    

    Sequence, based on observed residues (ATOM records): (download)
    >2axyD (D:)
    vtltirllmhgkevgsiigkkgesvkkmreesgarinisegncperiitlagptnaifka
    famiidkleed
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.