PDB entry 2axw

View 2axw on RCSB PDB site
Description: Structure of DraD invasin from uropathogenic Escherichia coli
Class: cell invasion
Keywords: homodimer, beta-sandwich, immunoglobulin-like fold, swapped c-terminal strands, cell invasion
Deposited on 2005-09-06, released 2005-11-01
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: 0.151
AEROSPACI score: 0.95 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DraD invasin
    Species: Escherichia coli [TaxId:562]
    Gene: draD
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7BG36 (0-120)
      • expression tag (121-133)
    Domains in SCOPe 2.01: d2axwa1
  • Chain 'B':
    Compound: DraD invasin
    Species: Escherichia coli [TaxId:562]
    Gene: draD
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7BG36 (0-120)
      • expression tag (121-133)
    Domains in SCOPe 2.01: d2axwb_
  • Heterogens: CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2axwA (A:)
    aelhlesrggsgtqlrdgakvatgriicreahtgfhvwmnerqvdgraeryvvqskdgrh
    elrvrtggdgwspvkgeggkgvsrpgqeeqvffdvmadgnqdiapgeyrfsvggacvvpq
    eklaaalehhhhhh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2axwB (B:)
    aelhlesrggsgtqlrdgakvatgriicreahtgfhvwmnerqvdgraeryvvqskdgrh
    elrvrtggdgwspvkgeggkgvsrpgqeeqvffdvmadgnqdiapgeyrfsvggacvvpq
    eklaaalehhhhhh