PDB entry 2axv

View 2axv on RCSB PDB site
Description: Structure of PrgX Y153C mutant
Class: transcription
Keywords: Repressor, pheromone, DNA binding, domain
Deposited on 2005-09-06, released 2005-12-06
The last revision prior to the SCOP 1.73 freeze date was dated 2005-12-06, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.242
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PrgX
    Species: Enterococcus faecalis
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04114
      • engineered (152)
    Domains in SCOP 1.73: d2axva1, d2axva2
  • Chain 'B':
    Compound: PrgX
    Species: Enterococcus faecalis
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04114
      • engineered (152)
    Domains in SCOP 1.73: d2axvb1, d2axvb2
  • Chain 'C':
    Compound: PrgX
    Species: Enterococcus faecalis
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04114
      • engineered (152)
    Domains in SCOP 1.73: d2axvc1, d2axvc2
  • Chain 'D':
    Compound: PrgX
    Species: Enterococcus faecalis
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04114
      • engineered (152)
    Domains in SCOP 1.73: d2axvd1, d2axvd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2axvA (A:)
    mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe
    ilnragmntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisia
    hhynievptfnktitsdlkhlydkrttffgidceivsnllnvlpyeevssiikpmypivd
    sfgkdydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylk
    qiyqfltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyye
    nyvaiennpipeikeqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2axvA (A:)
    fkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffei
    lnragmntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisiah
    hynievptfnktitsdlkhlydkrttffgidceivsnllnvlpyeevssiikpmypivds
    fgkdydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylkq
    iyqfltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyyen
    yv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2axvB (B:)
    mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe
    ilnragmntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisia
    hhynievptfnktitsdlkhlydkrttffgidceivsnllnvlpyeevssiikpmypivd
    sfgkdydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylk
    qiyqfltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyye
    nyvaiennpipeikeqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2axvB (B:)
    fkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffei
    lnragmntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisiah
    hynievptfnktitsdlkhlydkrttffgidceivsnllnvlpyeevssiikpmypivds
    fgkdydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylkq
    iyqfltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyyen
    yva
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2axvC (C:)
    mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe
    ilnragmntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisia
    hhynievptfnktitsdlkhlydkrttffgidceivsnllnvlpyeevssiikpmypivd
    sfgkdydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylk
    qiyqfltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyye
    nyvaiennpipeikeqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2axvC (C:)
    fkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffei
    lnragmntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisiah
    hynievptfnktitsdlkhlydkrttffgidceivsnllnvlpyeevssiikpmypivds
    fgkdydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylkq
    iyqfltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyyen
    yv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2axvD (D:)
    mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe
    ilnragmntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisia
    hhynievptfnktitsdlkhlydkrttffgidceivsnllnvlpyeevssiikpmypivd
    sfgkdydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylk
    qiyqfltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyye
    nyvaiennpipeikeqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2axvD (D:)
    fkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffei
    lnragmntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisiah
    hynievptfnktitsdlkhlydkrttffgidceivsnllnvlpyeevssiikpmypivds
    fgkdydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylkq
    iyqfltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyyen
    yv