PDB entry 2axu

View 2axu on RCSB PDB site
Description: Structure of PrgX
Class: transcription
Keywords: Repressor, pheromone, DNA binding, domain, TRANSCRIPTION
Deposited on 2005-09-06, released 2005-12-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.199
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PrgX
    Species: Enterococcus faecalis [TaxId:1351]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04114 (0-End)
      • modified residue (0)
      • modified residue (26)
      • modified residue (66)
      • modified residue (174)
      • modified residue (202)
    Domains in SCOPe 2.05: d2axua1, d2axua2
  • Chain 'B':
    Compound: PrgX
    Species: Enterococcus faecalis [TaxId:1351]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04114
      • modified residue (26)
      • modified residue (66)
      • modified residue (174)
      • modified residue (202)
    Domains in SCOPe 2.05: d2axub1, d2axub2
  • Chain 'C':
    Compound: PrgX
    Species: Enterococcus faecalis [TaxId:1351]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04114
      • modified residue (26)
      • modified residue (66)
      • modified residue (174)
      • modified residue (202)
    Domains in SCOPe 2.05: d2axuc1, d2axuc2
  • Chain 'D':
    Compound: PrgX
    Species: Enterococcus faecalis [TaxId:1351]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04114
      • modified residue (26)
      • modified residue (66)
      • modified residue (174)
      • modified residue (202)
    Domains in SCOPe 2.05: d2axud1, d2axud2
  • Chain 'E':
    Compound: PrgX
    Species: Enterococcus faecalis [TaxId:1351]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04114
      • modified residue (26)
      • modified residue (66)
      • modified residue (174)
      • modified residue (202)
    Domains in SCOPe 2.05: d2axue1, d2axue2
  • Chain 'F':
    Compound: PrgX
    Species: Enterococcus faecalis [TaxId:1351]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04114
      • modified residue (26)
      • modified residue (66)
      • modified residue (174)
      • modified residue (202)
    Domains in SCOPe 2.05: d2axuf1, d2axuf2
  • Chain 'G':
    Compound: PrgX
    Species: Enterococcus faecalis [TaxId:1351]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04114
      • modified residue (26)
      • modified residue (66)
      • modified residue (174)
      • modified residue (202)
    Domains in SCOPe 2.05: d2axug1, d2axug2
  • Chain 'H':
    Compound: PrgX
    Species: Enterococcus faecalis [TaxId:1351]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04114
      • modified residue (26)
      • modified residue (66)
      • modified residue (174)
      • modified residue (202)
    Domains in SCOPe 2.05: d2axuh1, d2axuh2
  • Chain 'I':
    Compound: PrgX
    Species: Enterococcus faecalis [TaxId:1351]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04114
      • modified residue (26)
      • modified residue (66)
      • modified residue (174)
      • modified residue (202)
    Domains in SCOPe 2.05: d2axui1, d2axui2
  • Chain 'J':
    Compound: PrgX
    Species: Enterococcus faecalis [TaxId:1351]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04114
      • modified residue (26)
      • modified residue (66)
      • modified residue (174)
      • modified residue (202)
    Domains in SCOPe 2.05: d2axuj1, d2axuj2
  • Chain 'K':
    Compound: PrgX
    Species: Enterococcus faecalis [TaxId:1351]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04114
      • modified residue (26)
      • modified residue (66)
      • modified residue (174)
      • modified residue (202)
    Domains in SCOPe 2.05: d2axuk1, d2axuk2
  • Chain 'L':
    Compound: PrgX
    Species: Enterococcus faecalis [TaxId:1351]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04114
      • modified residue (26)
      • modified residue (66)
      • modified residue (174)
      • modified residue (202)
    Domains in SCOPe 2.05: d2axul1, d2axul2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2axuA (A:)
    mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe
    ilnragmntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisia
    hhynievptfnktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivd
    sfgkdydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylk
    qiyqfltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyye
    nyvaiennpipeikeqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2axuA (A:)
    mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe
    ilnragmnsvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisiahh
    ynievptfnktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivdsf
    gkdydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylkqi
    yqfltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyyeny
    vai
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2axuB (B:)
    mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe
    ilnragmntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisia
    hhynievptfnktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivd
    sfgkdydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylk
    qiyqfltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyye
    nyvaiennpipeikeqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2axuB (B:)
    fkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffei
    lnragmnsvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisiahhy
    nievptfnktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivdsfg
    kdydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylkqiy
    qfltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyyenyv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2axuC (C:)
    mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe
    ilnragmntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisia
    hhynievptfnktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivd
    sfgkdydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylk
    qiyqfltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyye
    nyvaiennpipeikeqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2axuC (C:)
    kigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffeil
    nragmnsvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisiahhyn
    ievptfnktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivdsfgk
    dydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylkqiyq
    fltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyyenyv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2axuD (D:)
    mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe
    ilnragmntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisia
    hhynievptfnktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivd
    sfgkdydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylk
    qiyqfltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyye
    nyvaiennpipeikeqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2axuD (D:)
    kigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffeil
    nragmnsvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisiahhyn
    ievptfnktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivdsfgk
    dydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylkqiyq
    fltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyyeny
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2axuE (E:)
    mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe
    ilnragmntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisia
    hhynievptfnktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivd
    sfgkdydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylk
    qiyqfltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyye
    nyvaiennpipeikeqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2axuE (E:)
    kigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffeil
    nragmnsvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisiahhyn
    ievptfnktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivdsfgk
    dydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylkqiyq
    fltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyyenyva
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2axuF (F:)
    mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe
    ilnragmntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisia
    hhynievptfnktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivd
    sfgkdydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylk
    qiyqfltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyye
    nyvaiennpipeikeqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2axuF (F:)
    kigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffeil
    nragmnsvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisiahhyn
    ievptfnktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivdsfgk
    dydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylkqiyq
    fltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyyenyva
    i
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2axuG (G:)
    mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe
    ilnragmntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisia
    hhynievptfnktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivd
    sfgkdydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylk
    qiyqfltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyye
    nyvaiennpipeikeqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2axuG (G:)
    fkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffei
    lnragmnsvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisiahhy
    nievptfnktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivdsfg
    kdydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylkqiy
    qfltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyyenyv
    aie
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2axuH (H:)
    mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe
    ilnragmntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisia
    hhynievptfnktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivd
    sfgkdydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylk
    qiyqfltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyye
    nyvaiennpipeikeqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2axuH (H:)
    kigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffeil
    nragmnsvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisiahhyn
    ievptfnktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivdsfgk
    dydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylkqiyq
    fltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyyeny
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2axuI (I:)
    mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe
    ilnragmntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisia
    hhynievptfnktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivd
    sfgkdydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylk
    qiyqfltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyye
    nyvaiennpipeikeqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2axuI (I:)
    fkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffei
    lnragmnsvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisiahhy
    nievptfnktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivdsfg
    kdydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylkqiy
    qfltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyyenyv
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2axuJ (J:)
    mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe
    ilnragmntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisia
    hhynievptfnktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivd
    sfgkdydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylk
    qiyqfltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyye
    nyvaiennpipeikeqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2axuJ (J:)
    igsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffeiln
    ragmnsvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisiahhyni
    evptfnktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivdsfgkd
    ydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylkqiyqf
    ltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyyen
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2axuK (K:)
    mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe
    ilnragmntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisia
    hhynievptfnktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivd
    sfgkdydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylk
    qiyqfltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyye
    nyvaiennpipeikeqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2axuK (K:)
    igsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffeiln
    ragmnsvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisiahhyni
    evptfnktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivdsfgkd
    ydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylkqiyqf
    ltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyyenyva
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2axuL (L:)
    mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe
    ilnragmntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisia
    hhynievptfnktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivd
    sfgkdydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylk
    qiyqfltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyye
    nyvaiennpipeikeqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2axuL (L:)
    fkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffei
    lnragmnsvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisiahhy
    nievptfnktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivdsfg
    kdydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylkqiy
    qfltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyyeny