PDB entry 2axp

View 2axp on RCSB PDB site
Description: X-Ray Crystal Structure of Protein BSU20280 from Bacillus subtilis. Northeast Structural Genomics Consortium Target SR256.
Class: unknown function
Keywords: alpha beta protein., Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG
Deposited on 2005-09-05, released 2005-09-13
The last revision prior to the SCOP 1.73 freeze date was dated 2005-09-13, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.255
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein BSU20280
    Species: Bacillus subtilis subsp. subtilis
    Gene: yorR
    Database cross-references and differences (RAF-indexed):
    • Uniprot O31896 (Start-164)
      • modified residue (135)
      • cloning artifact (165-166)
      • his tag (167-172)
    Domains in SCOP 1.73: d2axpa1
  • Chain 'B':
    Compound: hypothetical protein BSU20280
    Species: Bacillus subtilis subsp. subtilis
    Gene: yorR
    Database cross-references and differences (RAF-indexed):
    • Uniprot O31896 (Start-164)
      • modified residue (135)
      • cloning artifact (165-166)
      • his tag (167-172)
    Domains in SCOP 1.73: d2axpb1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2axpA (A:)
    mtliilegpdccfkstvaaklskelkypiikgssfelaksgneklfehfnkladednvii
    drfvysnlvyakkfkdysilterqlrfiedkikakakvvylhadpsvikkrlrvrgdeyi
    egkdidsilelyrevmsnaglhtyswdtgqwssdeiakdiiflvelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2axpA (A:)
    tliilegpdccfkstvaaklskelkypiikgssfelaksgneklfehfnkladednviid
    rfvysnlvyakkfkdysilterqlrfiedkikakakvvylhadpsvikkrlrvrgdeyie
    gkdidsilelyrevmsnaglhtyswdtgqwssdeiakdiiflvelehhhhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2axpB (B:)
    mtliilegpdccfkstvaaklskelkypiikgssfelaksgneklfehfnkladednvii
    drfvysnlvyakkfkdysilterqlrfiedkikakakvvylhadpsvikkrlrvrgdeyi
    egkdidsilelyrevmsnaglhtyswdtgqwssdeiakdiiflvelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2axpB (B:)
    tliilegpdccfkstvaaklskelkypiikgssfelaksgneklfehfnkladednviid
    rfvysnlvyakkfkdysilterqlrfiedkikakakvvylhadpsvikkrlrvrgdeyie
    gkdidsilelyrevmsnaglhtyswdtgqwssdeiakdiiflvelehhhhhh