PDB entry 2axh

View 2axh on RCSB PDB site
Description: Crystal structures of T cell receptor beta chains related to rheumatoid arthritis
Class: immune system
Keywords: tcr, immune system
Deposited on 2005-09-05, released 2005-09-20
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.237
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: T cell receptor beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2axha1, d2axha2
  • Chain 'B':
    Compound: T cell receptor beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2axhb1, d2axhb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2axhA (A:)
    dggitqspkylfrkegqnvtlsceqnlnhdamywyrqdpgqglrliyysqivndfqkgdi
    aegysvsrekkesfpltvtsaqknptafylcassigqmneqyfgpgtrltvledlknvfp
    pevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpqplkeqpa
    lndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgr
    ad
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2axhB (B:)
    dggitqspkylfrkegqnvtlsceqnlnhdamywyrqdpgqglrliyysqivndfqkgdi
    aegysvsrekkesfpltvtsaqknptafylcassigqmneqyfgpgtrltvledlknvfp
    pevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpqplkeqpa
    lndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgr
    ad