PDB entry 2axe

View 2axe on RCSB PDB site
Description: iodinated complex of acetyl xylan esterase at 1.80 angstroms
Class: hydrolase
Keywords: hydrolase, iodotyrosines, esterase
Deposited on 1998-09-01, released 1999-05-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.173
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetyl xylan esterase
    Species: Penicillium purpurogenum [TaxId:28575]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O59893 (0-206)
      • modified (32)
      • modified (176)
    Domains in SCOPe 2.08: d2axea_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2axeA (A:)
scpaihvfgarettaspgygssstvvngvlsaypgstaeainypacggqsscggasysss
vaqgiaavasavnsfnsqcpstkivlvgysqggeimdvalcgggdpnqgytntavqlsss
avnmvkaaifmgdpmfraglsyevgtcaaggfdqrpagfscpsaakiksycdasdpyccn
gsnaathqgygseygsqalafvksklg