PDB entry 2axd

View 2axd on RCSB PDB site
Description: solution structure of the theta subunit of escherichia coli DNA polymerase III in complex with the epsilon subunit
Class: transferase
Keywords: theta subunit, DNA polymerase III, transferase
Deposited on 2005-09-05, released 2006-07-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'S':
  Compound: DNA polymerase III, theta subunit
  Species: Escherichia coli [TaxId:562]
  Gene: holE
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0ABS8 (0-75)
  Domains in SCOPe 2.07: d2axds_

PDB Chain Sequences:

• Chain 'S':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2axdS (S:)
  mlknlakldqtemdkvnvdlaaagvafkerynmpviaeavereqpehlrswfrerliahr
  lasvnlsrlpyepklk