PDB entry 2axd

View 2axd on RCSB PDB site
Description: solution structure of the theta subunit of escherichia coli DNA polymerase III in complex with the epsilon subunit
Class: transferase
Keywords: theta subunit, DNA polymerase III, transferase
Deposited on 2005-09-05, released 2006-07-04
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'S':
    Compound: DNA polymerase III, theta subunit
    Species: Escherichia coli [TaxId:562]
    Gene: holE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2axds1

PDB Chain Sequences:

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2axdS (S:)
    mlknlakldqtemdkvnvdlaaagvafkerynmpviaeavereqpehlrswfrerliahr
    lasvnlsrlpyepklk