PDB entry 2ax6

View 2ax6 on RCSB PDB site
Description: Crystal Structure Of The Androgen Receptor Ligand Binding Domain T877A Mutant In Complex With Hydroxyflutamide
Class: transcription
Keywords: transcription
Deposited on 2005-09-03, released 2005-09-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Androgen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: Ar
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10275
      • engineered (213)
    Domains in SCOPe 2.07: d2ax6a_
  • Heterogens: HFT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ax6A (A:)
    iegyecqpiflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalp
    gfrnlhvddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysq
    cvrmrhlsqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriia
    ckrknptscsrrfyqltklldsvqpiarelhqfafdllikshmvsvdfpemmaeiisvqv
    pkilsgkvkpiyfhtq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ax6A (A:)
    piflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnlhv
    ddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmrhl
    sqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiaptscsrr
    fyqltklldsvqpiarelhqfafdllikshmvsvdfpemmaeiisvqvpkilsgkvkpiy
    fh