PDB entry 2aww

View 2aww on RCSB PDB site
Description: Synapse associated protein 97 PDZ2 domain variant C378G with C-terminal GluR-A peptide
Class: membrane protein
Keywords: membrane protein, synaptic signaling, trafficking protein
Deposited on 2005-09-02, released 2006-08-29
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: 0.246
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Synapse associated protein 97
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Dlg1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q62696
      • see remark 999 (3-4)
      • conflict (38)
      • conflict (40)
      • engineered (64)
      • see remark 999 (88)
    Domains in SCOPe 2.02: d2awwa_
  • Chain 'B':
    Compound: Synapse associated protein 97
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Dlg1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q62696 (1-End)
      • see remark 999 (1)
      • see remark 999 (3-4)
      • conflict (38)
      • conflict (40)
      • engineered (64)
      • see remark 999 (88)
    Domains in SCOPe 2.02: d2awwb_
  • Chain 'C':
    Compound: 18-residue C-terminal peptide from glutamate receptor, ionotropic, AMPA1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • GB NP_113796 (Start-17)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2awwA (A:)
    mekimeiklikgpkglgfsiaggvgnqhipgdnsiyvtsiveggaahkdgklqigdklla
    vnsvgleevtheeavtalkntsdfvylkvakptsmyisrhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2awwA (A:)
    kimeiklikgpkglgfsiaggvgnqhipgdnsiyvtsiveggaahkdgklqigdkllavn
    svgleevtheeavtalkntsdfvylkvakpt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2awwB (B:)
    mekimeiklikgpkglgfsiaggvgnqhipgdnsiyvtsiveggaahkdgklqigdklla
    vnsvgleevtheeavtalkntsdfvylkvakptsmyisrhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2awwB (B:)
    ekimeiklikgpkglgfsiaggvgnqhipgdnsiyvtsiveggaahkdgklqigdkllav
    nsvgleevtheeavtalkntsdfvylkvakp
    

  • Chain 'C':
    No sequence available.