PDB entry 2awt

View 2awt on RCSB PDB site
Description: Solution Structure of Human Small Ubiquitin-Like Modifier Protein Isoform 2 (SUMO-2)
Class: protein transport
Keywords: ubiquitin fold, half-open barrel, two helices
Deposited on 2005-09-02, released 2006-10-24
The last revision prior to the SCOP 1.75 freeze date was dated 2006-10-24, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Small ubiquitin-related modifier 2
  Species: HOMO SAPIENS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61956 (0-94)
  Domains in SCOP 1.75: d2awta1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2awtA (A:)
  madekpkegvktenndhinlkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirf
  rfdgqpinetdtpaqlemededtidvfqqqtggvy