PDB entry 2awo

View 2awo on RCSB PDB site
Description: Crystal structure of the ADP-Mg-bound E. Coli MALK (Crystallized with ADP-Mg)
Class: transport protein
Keywords: ATP-binding cassette, transport protein
Deposited on 2005-09-01, released 2005-12-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.239
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Maltose/maltodextrin import ATP-binding protein malK
    Species: Escherichia coli [TaxId:83333]
    Gene: malK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68187 (Start-370)
      • cloning artifact (371-372)
    Domains in SCOPe 2.08: d2awoa1, d2awoa2, d2awoa3
  • Chain 'B':
    Compound: Maltose/maltodextrin import ATP-binding protein malK
    Species: Escherichia coli [TaxId:83333]
    Gene: malK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68187 (Start-370)
      • cloning artifact (371-374)
    Domains in SCOPe 2.08: d2awob1, d2awob2, d2awob3
  • Chain 'C':
    Compound: Maltose/maltodextrin import ATP-binding protein malK
    Species: Escherichia coli [TaxId:83333]
    Gene: malK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68187 (Start-370)
      • cloning artifact (371-374)
    Domains in SCOPe 2.08: d2awoc1, d2awoc2, d2awoc3
  • Chain 'D':
    Compound: Maltose/maltodextrin import ATP-binding protein malK
    Species: Escherichia coli [TaxId:83333]
    Gene: malK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68187 (Start-370)
      • cloning artifact (371-372)
    Domains in SCOPe 2.08: d2awod1, d2awod2, d2awod3
  • Heterogens: MG, ADP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2awoA (A:)
    masvqlqnvtkawgevvvskdinldihegefvvfvgpsgcgkstllrmiagletitsgdl
    figekrmndtppaergvgmvfqsyalyphlsvaenmsfglklagakkevinqrvnqvaev
    lqlahlldrkpkalsggqrqrvaigrtlvaepsvflldeplsnldaalrvqmrieisrlh
    krlgrtmiyvthdqveamtladkivvldagrvaqvgkplelyhypadrfvagfigspkmn
    flpvkvtataidqvqvelpmpnrqqvwlpvesrdvqvganmslgirpehllpsdiadvil
    egevqvveqlgnetqihiqipsirqnlvyrqndvvlveegatfaiglpperchlfredgt
    acrrlhkepgvasashhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2awoA (A:)
    asvqlqnvtkawgevvvskdinldihegefvvfvgpsgcgkstllrmiagletitsgdlf
    igekrmndtppaergvgmvfqsyalyphlsvaenmsfglklagakkevinqrvnqvaevl
    qlahlldrkpkalsggqrqrvaigrtlvaepsvflldeplsnldaalrvqmrieisrlhk
    rlgrtmiyvthdqveamtladkivvldagrvaqvgkplelyhypadrfvagfigspkmnf
    lpvkvtataidqvqvelpmpnrqqvwlpvesrdvqvganmslgirpehllpsdiadvile
    gevqvveqlgnetqihiqipsirqnlvyrqndvvlveegatfaiglpperchlfredgta
    crrlhkepgvas
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2awoB (B:)
    masvqlqnvtkawgevvvskdinldihegefvvfvgpsgcgkstllrmiagletitsgdl
    figekrmndtppaergvgmvfqsyalyphlsvaenmsfglklagakkevinqrvnqvaev
    lqlahlldrkpkalsggqrqrvaigrtlvaepsvflldeplsnldaalrvqmrieisrlh
    krlgrtmiyvthdqveamtladkivvldagrvaqvgkplelyhypadrfvagfigspkmn
    flpvkvtataidqvqvelpmpnrqqvwlpvesrdvqvganmslgirpehllpsdiadvil
    egevqvveqlgnetqihiqipsirqnlvyrqndvvlveegatfaiglpperchlfredgt
    acrrlhkepgvasashhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2awoB (B:)
    asvqlqnvtkawgevvvskdinldihegefvvfvgpsgcgkstllrmiagletitsgdlf
    igekrmndtppaergvgmvfqsyalyphlsvaenmsfglklagakkevinqrvnqvaevl
    qlahlldrkpkalsggqrqrvaigrtlvaepsvflldeplsnldaalrvqmrieisrlhk
    rlgrtmiyvthdqveamtladkivvldagrvaqvgkplelyhypadrfvagfigspkmnf
    lpvkvtataidqvqvelpmpnrqqvwlpvesrdvqvganmslgirpehllpsdiadvile
    gevqvveqlgnetqihiqipsirqnlvyrqndvvlveegatfaiglpperchlfredgta
    crrlhkepgvasas
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2awoC (C:)
    masvqlqnvtkawgevvvskdinldihegefvvfvgpsgcgkstllrmiagletitsgdl
    figekrmndtppaergvgmvfqsyalyphlsvaenmsfglklagakkevinqrvnqvaev
    lqlahlldrkpkalsggqrqrvaigrtlvaepsvflldeplsnldaalrvqmrieisrlh
    krlgrtmiyvthdqveamtladkivvldagrvaqvgkplelyhypadrfvagfigspkmn
    flpvkvtataidqvqvelpmpnrqqvwlpvesrdvqvganmslgirpehllpsdiadvil
    egevqvveqlgnetqihiqipsirqnlvyrqndvvlveegatfaiglpperchlfredgt
    acrrlhkepgvasashhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2awoC (C:)
    asvqlqnvtvskdinldihegefvvfvgpsgcgkstllrmiagletitsgdlfigekrmn
    dtppaergvgmvalyphlsvaenmsfglklagakkevinqrvnqvaevlqlahlldrkpk
    alsggqrqrvaigrtlvaepsvflldeplsnldaalrvqmrieisrlhkrlgrtmiyvth
    dqveamtladkivvldagrvaqvgkplelyhypadrfvagfigspkmnflpvkvtataid
    qvqvelpmpnrqqvwlpvesrdvqvganmslgirpehllpsdiadvilegevqvveqlgn
    etqihiqipsirqnlvyrqndvvlveegatfaiglpperchlfredgtacrrlhkepgva
    sas
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2awoD (D:)
    masvqlqnvtkawgevvvskdinldihegefvvfvgpsgcgkstllrmiagletitsgdl
    figekrmndtppaergvgmvfqsyalyphlsvaenmsfglklagakkevinqrvnqvaev
    lqlahlldrkpkalsggqrqrvaigrtlvaepsvflldeplsnldaalrvqmrieisrlh
    krlgrtmiyvthdqveamtladkivvldagrvaqvgkplelyhypadrfvagfigspkmn
    flpvkvtataidqvqvelpmpnrqqvwlpvesrdvqvganmslgirpehllpsdiadvil
    egevqvveqlgnetqihiqipsirqnlvyrqndvvlveegatfaiglpperchlfredgt
    acrrlhkepgvasashhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2awoD (D:)
    asvqlqnvtkawgevvvskdinldihegefvvfvgpsgcgkstllrmiagletitsgdlf
    igekrmndtppaergvgmvepsvflldepldaalrvqmrieisrlhkrlgrtmiyvthdq
    veamtladkivvldagrvaqvgkplelyhypadrfvagfigspkmnflpvkvtataidqv
    qvelpmpnrqqvwlpvesrdvqvganmslgirpehllpsdiadvilegevqvveqlgnet
    qihiqipsirqnlvyrqndvvlveegatfaiglpperchlfredgtacrrlhkepgvas