PDB entry 2awi

View 2awi on RCSB PDB site
Description: Structure of PrgX Y153C mutant
Class: transcription
Keywords: Repressor, pheromone, DNA binding, regulatory domain, TRANSCRIPTION
Deposited on 2005-09-01, released 2005-12-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.218
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PrgX
    Species: Enterococcus faecalis [TaxId:1351]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04114
      • modified residue (26)
      • modified residue (66)
      • engineered (152)
      • modified residue (174)
      • modified residue (202)
    Domains in SCOPe 2.07: d2awia1, d2awia2
  • Chain 'B':
    Compound: PrgX
    Species: Enterococcus faecalis [TaxId:1351]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04114
      • modified residue (26)
      • modified residue (66)
      • engineered (152)
      • modified residue (174)
      • modified residue (202)
    Domains in SCOPe 2.07: d2awib1, d2awib2
  • Chain 'C':
    Compound: PrgX
    Species: Enterococcus faecalis [TaxId:1351]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04114
      • modified residue (26)
      • modified residue (66)
      • engineered (152)
      • modified residue (174)
      • modified residue (202)
    Domains in SCOPe 2.07: d2awic1, d2awic2
  • Chain 'D':
    Compound: PrgX
    Species: Enterococcus faecalis [TaxId:1351]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04114
      • modified residue (26)
      • modified residue (66)
      • engineered (152)
      • modified residue (174)
      • modified residue (202)
    Domains in SCOPe 2.07: d2awid1, d2awid2
  • Chain 'E':
    Compound: PrgX
    Species: Enterococcus faecalis [TaxId:1351]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04114
      • modified residue (26)
      • modified residue (66)
      • engineered (152)
      • modified residue (174)
      • modified residue (202)
    Domains in SCOPe 2.07: d2awie1, d2awie2
  • Chain 'F':
    Compound: PrgX
    Species: Enterococcus faecalis [TaxId:1351]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04114
      • modified residue (26)
      • modified residue (66)
      • engineered (152)
      • modified residue (174)
      • modified residue (202)
    Domains in SCOPe 2.07: d2awif1, d2awif2
  • Chain 'G':
    Compound: PrgX
    Species: Enterococcus faecalis [TaxId:1351]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04114
      • modified residue (26)
      • modified residue (66)
      • engineered (152)
      • modified residue (174)
      • modified residue (202)
    Domains in SCOPe 2.07: d2awig1, d2awig2
  • Chain 'H':
    Compound: PrgX
    Species: Enterococcus faecalis [TaxId:1351]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04114
      • modified residue (26)
      • modified residue (66)
      • engineered (152)
      • modified residue (174)
      • modified residue (202)
    Domains in SCOPe 2.07: d2awih1, d2awih2
  • Chain 'I':
    Compound: PrgX
    Species: Enterococcus faecalis [TaxId:1351]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04114
      • modified residue (26)
      • modified residue (66)
      • engineered (152)
      • modified residue (174)
      • modified residue (202)
    Domains in SCOPe 2.07: d2awii1, d2awii2
  • Chain 'J':
    Compound: PrgX
    Species: Enterococcus faecalis [TaxId:1351]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04114
      • modified residue (26)
      • modified residue (66)
      • engineered (152)
      • modified residue (174)
      • modified residue (202)
    Domains in SCOPe 2.07: d2awij1, d2awij2
  • Chain 'K':
    Compound: PrgX
    Species: Enterococcus faecalis [TaxId:1351]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04114
      • modified residue (26)
      • modified residue (66)
      • engineered (152)
      • modified residue (174)
      • modified residue (202)
    Domains in SCOPe 2.07: d2awik1, d2awik2
  • Chain 'L':
    Compound: PrgX
    Species: Enterococcus faecalis [TaxId:1351]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04114
      • modified residue (26)
      • modified residue (66)
      • engineered (152)
      • modified residue (174)
      • modified residue (202)
    Domains in SCOPe 2.07: d2awil1, d2awil2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2awiA (A:)
    mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe
    ilnragmntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisia
    hhynievptfnktitsdlkhlydkrttffgidceivsnllnvlpyeevssiikpmypivd
    sfgkdydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylk
    qiyqfltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyye
    nyvaiennpipeikeqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2awiA (A:)
    fkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffei
    lnragmnsvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisiahhy
    nievptfnktitsdlkhlydkrttffgidceivsnllnvlpyeevssiikpmypivdsfg
    kdydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylkqiy
    qfltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyyen
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2awiB (B:)
    mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe
    ilnragmntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisia
    hhynievptfnktitsdlkhlydkrttffgidceivsnllnvlpyeevssiikpmypivd
    sfgkdydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylk
    qiyqfltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyye
    nyvaiennpipeikeqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2awiB (B:)
    fkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffei
    lnragmnsvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisiahhy
    nievptfnktitsdlkhlydkrttffgidceivsnllnvlpyeevssiikpmypivdsfg
    kdydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylkqiy
    qfltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyyen
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2awiC (C:)
    mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe
    ilnragmntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisia
    hhynievptfnktitsdlkhlydkrttffgidceivsnllnvlpyeevssiikpmypivd
    sfgkdydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylk
    qiyqfltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyye
    nyvaiennpipeikeqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2awiC (C:)
    kigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffeil
    nragmnsvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisiahhyn
    ievptfnktitsdlkhlydkrttffgidceivsnllnvlpyeevssiikpmypivdsfgk
    dydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylkqiyq
    fltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyyen
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2awiD (D:)
    mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe
    ilnragmntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisia
    hhynievptfnktitsdlkhlydkrttffgidceivsnllnvlpyeevssiikpmypivd
    sfgkdydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylk
    qiyqfltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyye
    nyvaiennpipeikeqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2awiD (D:)
    kigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffeil
    nragmnsvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisiahhyn
    ievptfnktitsdlkhlydkrttffgidceivsnllnvlpyeevssiikpmypivdsfgk
    dydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylkqiyq
    fltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyyen
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2awiE (E:)
    mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe
    ilnragmntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisia
    hhynievptfnktitsdlkhlydkrttffgidceivsnllnvlpyeevssiikpmypivd
    sfgkdydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylk
    qiyqfltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyye
    nyvaiennpipeikeqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2awiE (E:)
    kigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffeil
    nragmnsvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisiahhyn
    ievptfnktitsdlkhlydkrttffgidceivsnllnvlpyeevssiikpmypivdsfgk
    dydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylkqiyq
    fltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyyen
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2awiF (F:)
    mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe
    ilnragmntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisia
    hhynievptfnktitsdlkhlydkrttffgidceivsnllnvlpyeevssiikpmypivd
    sfgkdydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylk
    qiyqfltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyye
    nyvaiennpipeikeqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2awiF (F:)
    kigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffeil
    nragmnsvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisiahhyn
    ievptfnktitsdlkhlydkrttffgidceivsnllnvlpyeevssiikpmypivdsfgk
    dydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylkqiyq
    fltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyyen
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2awiG (G:)
    mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe
    ilnragmntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisia
    hhynievptfnktitsdlkhlydkrttffgidceivsnllnvlpyeevssiikpmypivd
    sfgkdydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylk
    qiyqfltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyye
    nyvaiennpipeikeqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2awiG (G:)
    igsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffeiln
    ragmnsvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisiahhyni
    evptfnktitsdlkhlydkrttffgidceivsnllnvlpyeevssiikpmypivdsfgkd
    ydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylkqiyqf
    ltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyyen
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2awiH (H:)
    mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe
    ilnragmntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisia
    hhynievptfnktitsdlkhlydkrttffgidceivsnllnvlpyeevssiikpmypivd
    sfgkdydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylk
    qiyqfltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyye
    nyvaiennpipeikeqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2awiH (H:)
    igsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffeiln
    ragmnsvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisiahhyni
    evptfnktitsdlkhlydkrttffgidceivsnllnvlpyeevssiikpmypivdsfgkd
    ydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylkqiyqf
    ltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyyen
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2awiI (I:)
    mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe
    ilnragmntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisia
    hhynievptfnktitsdlkhlydkrttffgidceivsnllnvlpyeevssiikpmypivd
    sfgkdydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylk
    qiyqfltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyye
    nyvaiennpipeikeqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2awiI (I:)
    fkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffei
    lnragmnsvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisiahhy
    nievptfnktitsdlkhlydkrttffgidceivsnllnvlpyeevssiikpmypivdsfg
    kdydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylkqiy
    qfltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyyen
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2awiJ (J:)
    mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe
    ilnragmntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisia
    hhynievptfnktitsdlkhlydkrttffgidceivsnllnvlpyeevssiikpmypivd
    sfgkdydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylk
    qiyqfltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyye
    nyvaiennpipeikeqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2awiJ (J:)
    igsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffeiln
    ragmnsvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisiahhyni
    evptfnktitsdlkhlydkrttffgidceivsnllnvlpyeevssiikpmypivdsfgkd
    ydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylkqiyqf
    ltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyyen
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2awiK (K:)
    mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe
    ilnragmntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisia
    hhynievptfnktitsdlkhlydkrttffgidceivsnllnvlpyeevssiikpmypivd
    sfgkdydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylk
    qiyqfltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyye
    nyvaiennpipeikeqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2awiK (K:)
    igsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffeiln
    ragmnsvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisiahhyni
    evptfnktitsdlkhlydkrttffgidceivsnllnvlpyeevssiikpmypivdsfgkd
    ydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylkqiyqf
    ltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyyen
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2awiL (L:)
    mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe
    ilnragmntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisia
    hhynievptfnktitsdlkhlydkrttffgidceivsnllnvlpyeevssiikpmypivd
    sfgkdydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylk
    qiyqfltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyye
    nyvaiennpipeikeqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2awiL (L:)
    igsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffeiln
    ragmnsvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisiahhyni
    evptfnktitsdlkhlydkrttffgidceivsnllnvlpyeevssiikpmypivdsfgkd
    ydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylkqiyqf
    ltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyyen