PDB entry 2awh

View 2awh on RCSB PDB site
Description: Human Nuclear Receptor-Ligand Complex 1
Class: gene regulation
Keywords: Nuclear Receptor, Protein-ligand complex, PPAR, GENE REGULATION
Deposited on 2005-09-01, released 2006-02-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.238
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator activated receptor delta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03181 (0-267)
      • conflict (220)
    Domains in SCOPe 2.06: d2awha_
  • Chain 'B':
    Compound: Peroxisome proliferator activated receptor delta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03181 (0-End)
      • conflict (220)
    Domains in SCOPe 2.06: d2awhb_
  • Heterogens: B7G, VCA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2awhA (A:)
    dlkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekglvwkqlvn
    glppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheaifam
    lasivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfia
    aiilcgdrpglmnvprveaiqdtilralefhlqanhpdaqqlfpkllqkmadlrqlvteh
    aqmmqrikktetetslhpllqeiykdmy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2awhA (A:)
    dlkafskhiynaylknfnmtkkkarsilthtapfvihdietlwqaekglvwkeisvhvfy
    rcqcttvetvreltefaksipsfsslflndqvtllkygvheaifamlasivnkdgllvan
    gsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaaiilcgdrpglmnv
    prveaiqdtilralefhlqanhpdaqqlfpkllqkmadlrqlvtehaqmmqrikktetet
    slhpllqeiykdmy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2awhB (B:)
    dlkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekglvwkqlvn
    glppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheaifam
    lasivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfia
    aiilcgdrpglmnvprveaiqdtilralefhlqanhpdaqqlfpkllqkmadlrqlvteh
    aqmmqrikktetetslhpllqeiykdmy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2awhB (B:)
    dlkafskhiynaylknfnmtkkkarsiltapfvihdietlwqaekglvweisvhvfyrcq
    cttvetvreltefaksipsfsslflndqvtllkygvheaifamlasivnkdgllvangsg
    fvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaaiilcgdrpglmnvprv
    eaiqdtilralefhlqanhpdaqqlfpkllqkmadlrqlvtehaqmmqrikktetetslh
    pllqeiykdm