PDB entry 2awf

View 2awf on RCSB PDB site
Description: Structure of human Ubiquitin-conjugating enzyme E2 G1
Class: ligase
Keywords: Ligase, Ubl conjugation pathway, ubiquitin-conjugating enzyme, Structural Genomics, Structural Genomics Consortium, SGC
Deposited on 2005-09-01, released 2005-09-20
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-11-28, with a file datestamp of 2012-11-23.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.223
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-conjugating enzyme E2 G1
    Species: Homo sapiens [TaxId:9606]
    Gene: UBE2G1, UBE2G
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62253 (19-End)
      • cloning artifact (12-18)
    Domains in SCOPe 2.04: d2awfa1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2awfA (A:)
    mgsshhhhhhssglvprgslllrrqlaelnknpvegfsagliddndlyrwevliigppdt
    lyeggvfkahltfpkdyplrppkmkfiteiwhpnvdkngdvcisilhepgedkygyekpe
    erwlpihtvetimisvismladpngdspanvdaakewredrngefkrkvarc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2awfA (A:)
    glvprgslllrrqlaelnknpvegfsagliddndlyrwevliigppdtlyeggvfkahlt
    fpkdyplrppkmkfiteiwhpnvdkngdvcisilheppeerwlpihtvetimisvismla
    dp