PDB entry 2aw9

View 2aw9 on RCSB PDB site
Description: Superoxide dismutase with manganese from Deinococcus radiodurans
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2005-08-31, released 2006-08-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Mn]
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene: sodA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RUV2 (2-211)
      • cloning artifact (1)
      • cloning artifact (212-213)
    Domains in SCOPe 2.07: d2aw9a1, d2aw9a2, d2aw9a3, d2aw9a4
  • Chain 'B':
    Compound: Superoxide dismutase [Mn]
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene: sodA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RUV2 (2-211)
      • cloning artifact (1)
    Domains in SCOPe 2.07: d2aw9b1, d2aw9b2, d2aw9b3
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2aw9A (A:)
    maaytlpqlpyaydalephidartmeihhtkhhqtyvdnankalegtefadlpveqliqq
    ldrvpadkkgalrnnagghanhsmfwqimgqgqgqnganqpsgelldainsafgsfdafk
    qkfedaaktrfgsgwawlvvkdgkldvvstanqdnplmgeaiagvsgtpilgvdvwehay
    ylnyqnrrpdylaafwnvvnwdevskryaaaklvprgsaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aw9A (A:)
    aaytlpqlpyaydalephidartmeihhtkhhqtyvdnankalegtefadlpveqliqql
    drvpadkkgalrnnagghanhsmfwqimgqgqganqpsgelldainsafgsfdafkqkfe
    daaktrfgsgwawlvvkdgkldvvstanqdnplmgeaiagvsgtpilgvdvwehayylny
    qnrrpdylaafwnvvnwdevskryaaaklv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2aw9B (B:)
    maaytlpqlpyaydalephidartmeihhtkhhqtyvdnankalegtefadlpveqliqq
    ldrvpadkkgalrnnagghanhsmfwqimgqgqgqnganqpsgelldainsafgsfdafk
    qkfedaaktrfgsgwawlvvkdgkldvvstanqdnplmgeaiagvsgtpilgvdvwehay
    ylnyqnrrpdylaafwnvvnwdevskryaaaklvprgsaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aw9B (B:)
    aaytlpqlpyaydalephidartmeihhtkhhqtyvdnankalegtefadlpveqliqql
    drvpadkkgalrnnagghanhsmfwqimgqgqganqpsgelldainsafgsfdafkqkfe
    daaktrfgsgwawlvvkdgkldvvstanqdnplmgeaiagvsgtpilgvdvwehayylny
    qnrrpdylaafwnvvnwdevskryaaak