PDB entry 2aw7

View 2aw7 on RCSB PDB site
Description: Crystal structure of the bacterial ribosome from Escherichia coli at 3.5 A resolution. This file contains the 30S subunit of the second 70S ribosome. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
Class: ribosome
Keywords: RNA-protein complex, 30S RIBOSOMAL SUBUNIT, ribosome
Deposited on 2005-08-31, released 2005-11-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: XRAY
Resolution: 3.46 Å
R-factor: 0.279
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 16S ribosomal RNA
    Species: Escherichia coli [TaxId:562]
  • Chain 'B':
    Compound: 30S ribosomal protein S2
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2aw7b1
  • Chain 'C':
    Compound: 30S ribosomal protein S3
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2aw7c1, d2aw7c2
  • Chain 'D':
    Compound: 30S ribosomal protein S4
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2aw7d1
  • Chain 'E':
    Compound: 30S ribosomal protein S5
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2aw7e1, d2aw7e2
  • Chain 'F':
    Compound: 30S ribosomal protein S6
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2aw7f1
  • Chain 'G':
    Compound: 30S ribosomal protein S7
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2aw7g1
  • Chain 'H':
    Compound: 30S ribosomal protein S8
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2aw7h1
  • Chain 'I':
    Compound: 30S ribosomal protein S9
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2aw7i1
  • Chain 'J':
    Compound: 30S ribosomal protein S10
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2aw7j1
  • Chain 'K':
    Compound: 30S ribosomal protein S11
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2aw7k1
  • Chain 'L':
    Compound: 30S ribosomal protein S12
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2aw7l1
  • Chain 'M':
    Compound: 30S ribosomal protein S13
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2aw7m1
  • Chain 'N':
    Compound: 30S ribosomal protein S14
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2aw7n1
  • Chain 'O':
    Compound: 30S ribosomal protein S15
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2aw7o1
  • Chain 'P':
    Compound: 30S ribosomal protein S16
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2aw7p1
  • Chain 'Q':
    Compound: 30S ribosomal protein S17
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2aw7q1
  • Chain 'R':
    Compound: 30S ribosomal protein S18
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2aw7r1
  • Chain 'S':
    Compound: 30S ribosomal protein S19
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2aw7s1
  • Chain 'T':
    Compound: 30S ribosomal protein S20
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2aw7t1
  • Chain 'U':
    Compound: 30S ribosomal protein S21
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2aw7u1
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2aw7B (B:)
    atvsmrdmlkagvhfghqtrywnpkmkpfifgarnkvhiinlektvpmfnealaelnkia
    srkgkilfvgtkraaseavkdaalscdqffvnhrwlggmltnwktvrqsikrlkdletqs
    qdgtfdkltkkealmrtreleklenslggikdmgglpdalfvidadhehiaikeannlgi
    pvfaivdtnsdpdgvdfvipgnddairavtlylgavaatvregrsqdlasqaeesfveae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aw7B (B:)
    mlkagvhfghqtrywnpkmkpfifgarnkvhiinlektvpmfnealaelnkiasrkgkil
    fvgtkraaseavkdaalscdqffvnhrwlggmltnwktvrqsikrlkdletqsqdgtfdk
    ltkkealmrtreleklenslggikdmgglpdalfvidadhehiaikeannlgipvfaivd
    tnsdpdgvdfvipgnddairavtlylgavaatvregrs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2aw7C (C:)
    gqkvhpngirlgivkpwnstwfantkefadnldsdfkvrqyltkelakasvsrivierpa
    ksirvtihtarpgivigkkgedveklrkvvadiagvpaqiniaevrkpeldaklvadsit
    sqlerrvmfrramkravqnamrlgakgikvevsgrlggaeiartewyregrvplhtlrad
    idyntseahttygvigvkvwifkgeilggmaaveqpekpaaqpkkqqrkgrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aw7C (C:)
    gqkvhpngirlgivkpwnstwfantkefadnldsdfkvrqyltkelakasvsrivierpa
    ksirvtihtarpgivigkkgedveklrkvvadiagvpaqiniaevrkpeldaklvadsit
    sqlerrvmfrramkravqnamrlgakgikvevsgrlggaeiartewyregrvplhtlrad
    idyntseahttygvigvkvwifkgei
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2aw7D (D:)
    arylgpklklsrregtdlflksgvraidtkckieqapgqhgarkprlsdygvqlrekqkv
    rriygvlerqfrnyykeaarlkgntgenllallegrldnvvyrmgfgatraearqlvshk
    aimvngrvvniasyqvspndvvsirekakkqsrvkaalelaeqrekptwlevdagkmegt
    fkrkpersdlsadinehlivelysk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2aw7E (E:)
    ahiekqagelqekliavnrvsktvkggrifsftaltvvgdgngrvgfgygkarevpaaiq
    kamekarrnminvalnngtlqhpvkgvhtgsrvfmqpasegtgiiaggamravlevagvh
    nvlakaygstnpinvvratidglenmnspemvaakrgksveeilgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aw7E (E:)
    elqekliavnrvsktvkggrifsftaltvvgdgngrvgfgygkarevpaaiqkamekarr
    nminvalnngtlqhpvkgvhtgsrvfmqpasegtgiiaggamravlevagvhnvlakayg
    stnpinvvratidglenmnspemvaakrgk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2aw7F (F:)
    mrhyeivfmvhpdqseqvpgmierytaaitgaegkihrledwgrrqlaypinklhkahyv
    lmnveapqevidelettfrfndavirsmvmrtkhavteaspmvkakderrerrddfanet
    addaeagdseeeeee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aw7F (F:)
    mrhyeivfmvhpdqseqvpgmierytaaitgaegkihrledwgrrqlaypinklhkahyv
    lmnveapqevidelettfrfndavirsmvmrtkhavteas
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2aw7G (G:)
    prrrvigqrkilpdpkfgsellakfvnilmvdgkkstaesivysaletlaqrsgkselea
    fevalenvrptvevksrrvggstyqvpvevrpvrrnalamrwiveaarkrgdksmalrla
    nelsdaaenkgtavkkredvhrmaeankafahyrwlslrsfshqagasskqpalgyln
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aw7G (G:)
    rrrvigqrkilpdpkfgsellakfvnilmvdgkkstaesivysaletlaqrsgkseleaf
    evalenvrptvevksrrvggstyqvpvevrpvrrnalamrwiveaarkrgdksmalrlan
    elsdaaenkgtavkkredvhrmaeankafahy
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2aw7H (H:)
    smqdpiadmltrirngqaankaavtmpssklkvaianvlkeegfiedfkvegdtkpelel
    tlkyfqgkavvesiqrvsrpglriykrkdelpkvmaglgiavvstskgvmtdraarqagl
    ggeiicyva
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2aw7I (I:)
    aenqyygtgrrkssaarvfikpgngkivinqrsleqyfgretarmvvrqplelvdmvekl
    dlyitvkgggisgqagairhgitralmeydeslrselrkagfvtrdarqverkkvglrka
    rrrpqfskr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aw7I (I:)
    nqyygtgrrkssaarvfikpgngkivinqrsleqyfgretarmvvrqplelvdmvekldl
    yitvkgggisgqagairhgitralmeydeslrselrkagfvtrdarqverkkvglrkarr
    rpqfskr
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2aw7J (J:)
    mqnqririrlkafdhrlidqataeivetakrtgaqvrgpiplptrkerftvlisphvnkd
    ardqyeirthlrlvdiveptektvdalmrldlaagvdvqislg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aw7J (J:)
    ririrlkafdhrlidqataeivetakrtgaqvrgpiplptrkerftvlisphvnkdardq
    yeirthlrlvdiveptektvdalmrldlaagvdvqisl
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2aw7K (K:)
    akapirarkrvrkqvsdgvahihasfnntivtitdrqgnalgwataggsgfrgsrkstpf
    aaqvaaercadavkeygiknlevmvkgpgpgrestiralnaagfritnitdvtpiphngc
    rppkkrrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aw7K (K:)
    rkqvsdgvahihasfnntivtitdrqgnalgwataggsgfrgsrkstpfaaqvaaercad
    avkeygiknlevmvkgpgpgrestiralnaagfritnitdvtpiphngcrppkkrrv
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2aw7L (L:)
    atvnqlvrkprarkvaksnvpaleacpqkrgvctrvytttpkkpnsalrkvcrvrltngf
    evtsyiggeghnlqehsvilirggrvkdlpgvryhtvrgaldcsgvkdrkqarskygvkr
    pka
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2aw7M (M:)
    ariaginipdhkhavialtsiygvgktrskailaaagiaedvkiselsegqidtlrdeva
    kfvvegdlrreismsikrlmdlgcyrglrhrrglpvrgqrtktnartrkgprkpikk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aw7M (M:)
    ariaginipdhkhavialtsiygvgktrskailaaagiaedvkiselsegqidtlrdeva
    kfvvegdlrreismsikrlmdlgcyrglrhrrglpvrgqrtktnartrkgprk
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2aw7N (N:)
    akqsmkarevkrvaladkyfakraelkaiisdvnasdedrwnavlklqtlprdsspsrqr
    nrcrqtgrphgflrkfglsrikvreaamrgeipglkkasw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aw7N (N:)
    akqsmkarevkrvaladkyfakraelkaiisdvnarwnavlklqtlprdsspsrqrnrcr
    qtgrphgflrkfglsrikvreaamrgeipglkkasw
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >2aw7O (O:)
    mslsteatakivsefgrdandtgstevqvalltaqinhlqghfaehkkdhhsrrgllrmv
    sqrrklldylkrkdvarytrlierlglrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aw7O (O:)
    slsteatakivsefgrdandtgstevqvalltaqinhlqghfaehkkdhhsrrgllrmvs
    qrrklldylkrkdvarytrlierlglrr
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >2aw7P (P:)
    mvtirlarhgakkrpfyqvvvadsrnarngrfiervgffnpiasekeegtrldldriahw
    vgqgatisdrvaalikevnkaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aw7P (P:)
    mvtirlarhgakkrpfyqvvvadsrnarngrfiervgffnpiasekeegtrldldriahw
    vgqgatisdrvaalikevnk
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >2aw7Q (Q:)
    tdkirtlqgrvvsdkmeksivvaierfvkhpiygkfikrttklhvhdennecgigdvvei
    recrplsktkswtlvrvvekavl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aw7Q (Q:)
    kirtlqgrvvsdkmeksivvaierfvkhpiygkfikrttklhvhdennecgigdvveire
    crplsktkswtlvrvvekavl
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >2aw7R (R:)
    aryfrrrkfcrftaegvqeidykdiatlknyitesgkivpsritgtrakyqrqlaraikr
    arylsllpytdrhq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aw7R (R:)
    eidykdiatlknyitesgkivpsritgtrakyqrqlaraikrarylsllpytdrh
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >2aw7S (S:)
    prslkkgpfidlhllkkvekavesgdkkplrtwsrrstifpnmigltiavhngrqhvpvf
    vtdemvghklgefaptrtyrghaadkkakkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aw7S (S:)
    prslkkgpfidlhllkkvekavesgdkkplrtwsrrstifpnmigltiavhngrqhvpvf
    vtdemvghklgefaptrtyr
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >2aw7T (T:)
    aniksakkraiqsekarkhnasrrsmmrtfikkvyaaieagdkaaaqkafnemqpivdrq
    aakglihknkaarhkanltaqinkla
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aw7T (T:)
    niksakkraiqsekarkhnasrrsmmrtfikkvyaaieagdkaaaqkafnemqpivdrqa
    akglihknkaarhkanltaqinkla
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >2aw7U (U:)
    mpvikvrenepfdvalrrfkrscekagvlaevrrrefyekptterkrakasavkrhakkl
    arenarrtrly
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aw7U (U:)
    ikvrenepfdvalrrfkrscekagvlaevrrrefyekptterkrakasavk