PDB entry 2aw6

View 2aw6 on RCSB PDB site
Description: Structure of a bacterial peptide pheromone/receptor complex and its mechanism of gene regulation
Class: transcription
Keywords: Repressor, pheromone, DNA binding, regulatory, TRANSCRIPTION
Deposited on 2005-08-31, released 2005-12-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.214
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PrgX
    Species: Enterococcus faecalis [TaxId:1351]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2aw6a1, d2aw6a2
  • Chain 'B':
    Compound: PrgX
    Species: Enterococcus faecalis [TaxId:1351]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2aw6b1, d2aw6b2
  • Chain 'E':
    Compound: peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 2AW6 (0-6)
  • Chain 'F':
    Compound: peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 2AW6 (0-6)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2aw6A (A:)
    mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe
    ilnragmntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisia
    hhynievptfnktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivd
    sfgkdydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylk
    qiyqfltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyye
    nyvaiennpipeikeqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aw6A (A:)
    mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe
    ilnragmntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisia
    hhynievptfnktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivd
    sfgkdydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylk
    qiyqfltdknidsylnavniinifkiigkedihrslveeltkisake
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2aw6B (B:)
    mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe
    ilnragmntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisia
    hhynievptfnktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivd
    sfgkdydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylk
    qiyqfltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyye
    nyvaiennpipeikeqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aw6B (B:)
    mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe
    ilnragmntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisia
    hhynievptfnktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivd
    sfgkdydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylk
    qiyqfltdknidsylnavniinifkiigkedihrslveeltkisak
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.