PDB entry 2aw5

View 2aw5 on RCSB PDB site
Description: Crystal structure of a human malic enzyme
Class: Oxidoreductase
Keywords: Rossmann fold, Structural Genomics, Structural Genomics Consortium, SGC, Oxidoreductase
Deposited on 2005-08-31, released 2005-09-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.21
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NADP-dependent malic enzyme
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2aw5a1, d2aw5a2
  • Chain 'B':
    Compound: NADP-dependent malic enzyme
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2aw5b1, d2aw5b2
  • Chain 'C':
    Compound: NADP-dependent malic enzyme
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2aw5c1, d2aw5c2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2aw5A (A:)
    mhhhhhhssgvdlgtenlyfqsmqrgylltrnphlnkdlaftleerqqlnihgllppsfn
    sqeiqvlrvvknfehlnsdfdrylllmdlqdrneklfyrvltsdiekfmpivytptvgla
    cqqyslvfrkprglfitihdrghiasvlnawpedvikaivvtdgerilglgdlgcngmgi
    pvgklalytacggmnpqeclpvildvgteneellkdplyiglrqrrvrgseyddfldefm
    eavsskygmncliqfedfanvnafrllnkyrnqyctfnddiqgtasvavagllaalritk
    nklsdqtilfqgageaalgiahlivmalekeglpkekaikkiwlvdskglivkgrasltq
    ekekfaheheemknleaivqeikptaligvaaiggafseqilkdmaafnerpiifalsnp
    tskaecsaeqcykitkgraifasgspfdpvtlpngqtlypgqgnnsyvfpgvalgvvacg
    lrqitdniflttaeviaqqvsdkhleegrlypplntirdvslkiaekivkdayqektatv
    ypepqnkeafvrsqmystdydqilpdcyswpeevq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aw5A (A:)
    gylltrnphlnkdlaftleerqqlnihgllppsfnsqeiqvlrvvknfehlnsdfdryll
    lmdlqdrneklfyrvltsiekfmpivytptvglacqqyslvfrkprglfitihdrghias
    vlnawpedvikaivvtdgerilglgdlgcngmgipvgklalytacggmnpqeclpvildv
    gteneellkdplyiglrqrrvrgseyddfldefmeavsskygmncliqfedfanvnafrl
    lnkyrnqyctfnddiqgtasvavagllaalritknklsdqtilfqgageaalgiahlivm
    alekeglpkekaikkiwlvdskglivkgqekekfaheheemknleaivqeikptaligva
    aiggafseqilkdmaafnerpiifalsnptskaecsaeqcykitkgraifasgspfdpvt
    lpngqtlypgqgnnsyvfpgvalgvvacglrqitdniflttaeviaqqvsdkhleegrly
    pplntirdvslkiaekivkdayqektatvypepqnkeafvrsqmystdydq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2aw5B (B:)
    mhhhhhhssgvdlgtenlyfqsmqrgylltrnphlnkdlaftleerqqlnihgllppsfn
    sqeiqvlrvvknfehlnsdfdrylllmdlqdrneklfyrvltsdiekfmpivytptvgla
    cqqyslvfrkprglfitihdrghiasvlnawpedvikaivvtdgerilglgdlgcngmgi
    pvgklalytacggmnpqeclpvildvgteneellkdplyiglrqrrvrgseyddfldefm
    eavsskygmncliqfedfanvnafrllnkyrnqyctfnddiqgtasvavagllaalritk
    nklsdqtilfqgageaalgiahlivmalekeglpkekaikkiwlvdskglivkgrasltq
    ekekfaheheemknleaivqeikptaligvaaiggafseqilkdmaafnerpiifalsnp
    tskaecsaeqcykitkgraifasgspfdpvtlpngqtlypgqgnnsyvfpgvalgvvacg
    lrqitdniflttaeviaqqvsdkhleegrlypplntirdvslkiaekivkdayqektatv
    ypepqnkeafvrsqmystdydqilpdcyswpeevq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aw5B (B:)
    gylltrnphlnkdlaftleerqqlnihgllppsfnsqeiqvlrvvknfehlnsdfdryll
    lmdlqdrneklfyrvltsdiekfmpivytptvglacqqyslvfrkprglfitihdrghia
    svlnawpedvikaivvtdgerilglgdlgcngmgipvgklalytacggmnpqeclpvild
    vgteneellkdplyiglrqrrvrgseyddfldefmeavsskygmncliqfedfanvnafr
    llnkyrnqyctfnddiqgtasvavagllaalritknklsdqtilfqgageaalgiahliv
    malekeglpkekaikkiwlvdskglivkgqekekfaheheemknleaivqeikptaligv
    aaiggafseqilkdmaafnerpiifalsnptskaecsaeqcykitkgraifasgspfdpv
    tlpngqtlypgqgnnsyvfpgvalgvvacglrqitdniflttaeviaqqvsdkhleegrl
    ypplntirdvslkiaekivkdayqektatvypepqnkeafvrsqmystdydqilpd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2aw5C (C:)
    mhhhhhhssgvdlgtenlyfqsmqrgylltrnphlnkdlaftleerqqlnihgllppsfn
    sqeiqvlrvvknfehlnsdfdrylllmdlqdrneklfyrvltsdiekfmpivytptvgla
    cqqyslvfrkprglfitihdrghiasvlnawpedvikaivvtdgerilglgdlgcngmgi
    pvgklalytacggmnpqeclpvildvgteneellkdplyiglrqrrvrgseyddfldefm
    eavsskygmncliqfedfanvnafrllnkyrnqyctfnddiqgtasvavagllaalritk
    nklsdqtilfqgageaalgiahlivmalekeglpkekaikkiwlvdskglivkgrasltq
    ekekfaheheemknleaivqeikptaligvaaiggafseqilkdmaafnerpiifalsnp
    tskaecsaeqcykitkgraifasgspfdpvtlpngqtlypgqgnnsyvfpgvalgvvacg
    lrqitdniflttaeviaqqvsdkhleegrlypplntirdvslkiaekivkdayqektatv
    ypepqnkeafvrsqmystdydqilpdcyswpeevq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aw5C (C:)
    gylltrnphlnkdlaftleerqqlnihgllppsfnsqeiqvlrvvknfehlnsdfdryll
    lmdlqdrneklfyrvltsdiekfmpivytptvglacqqyslvfrkprglfitihdrghia
    svlnawpedvikaivvtdgerilglgdlgcngmgipvgklalytacggmnpqeclpvild
    vgteneellkdplyiglrqrrvrgseyddfldefmeavsskygmncliqfedfanvnafr
    llnkyrnqyctfnddiqgtasvavagllaalritknklsdqtilfqgageaalgiahliv
    malekeglpkekaikkiwlvdskglivkgqekekfaheheemknleaivqeikptaligv
    aaiggafseqilkdmaafnerpiifalsnptskaecsaeqcykitkgraifasgspfdpv
    tlpngqtlypgqgnnsyvfpgvalgvvacglrqitdniflttaeviaqqvsdkhleegrl
    ypplntirdvslkiaekivkdayqektatvypepqnkeafvrsqmystdydqi