PDB entry 2aw0

View 2aw0 on RCSB PDB site
Description: fourth metal-binding domain of the menkes copper-transporting ATPase, nmr, 20 structures
Class: copper transport
Keywords: copper-transporting ATPase, copper-binding domain, hydrolase, copper transport
Deposited on 1997-10-08, released 1998-01-14
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: menkes copper-transporting ATPase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2aw0a_
  • Heterogens: AG

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2aw0A (A:)
    ltqetvinidgmtcnscvqsiegviskkpgvksirvslansngtveydplltspetlrga
    iedmgfdatlsd