PDB entry 2aw0

View 2aw0 on RCSB PDB site
Description: fourth metal-binding domain of the menkes copper-transporting atpase, nmr, 20 structures
Deposited on 1997-10-08, released 1998-01-14
The last revision prior to the SCOP 1.57 freeze date was dated 1998-01-14, with a file datestamp of 1998-01-14.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d2aw0__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2aw0_ (-)
    ltqetvinidgmtcnscvqsiegviskkpgvksirvslansngtveydplltspetlrga
    iedmgfdatlsd